SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE04428 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE04428
Domain Number - Region: 160-178
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0293
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE04428
Sequence length 247
Comment (Caenorhabditis remanei)
Sequence
MPASRSSSSSSTGTVRSSSSGKAENSTTASTTSEASKVKTTGQQVKSQSDRGQRVIGNRQ
SGVGASSTKTIQSIKSRLYDILNELDDAEQQEIRQERINYLRKKKTHADVKEPAAPEEKT
PDANNTGAASSRLQGRVEHPKAAHPVRPAHKVKRHAFVGGCIYCRKAGHAAEYCTIYRSV
QARLDICRKRKYCVLCLYSNHQLDTCRSKKSKFACPYCSAYHHKSLCETRHGRMQSKVQK
AVEQKQK
Download sequence
Identical sequences E3NQA7
CRE04428 XP_003089414.1.11157 31234.CRE04428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]