SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE04783 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE04783
Domain Number - Region: 92-128
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00174
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Domain Number - Region: 55-80
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0128
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE04783
Sequence length 214
Comment (Caenorhabditis remanei)
Sequence
MQKPPSPSPSSKVPQLTSIDAEPKGASRGINSDTPASSIQDASSLVSPGRLPLHGRKRHR
FWSGCLFCSQRGHAAAYCEKFDVESRWAAVERRKWCSICLMSGHLFDNCRAKTRKNACRF
CSGMHHPALCRDKWGPQDNVIAPKKPREEANDEKPDDPMEEGVDEENHPKTGNPKTEEND
VSDMDSEESDARKPRTYGIYDVHIDLDGSEDDDQ
Download sequence
Identical sequences E3LZ85
XP_003110786.1.11157 CRE04783 31234.CRE04783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]