SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE04972 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE04972
Domain Number 1 Region: 698-755
Classification Level Classification E-value
Superfamily Acid proteases 0.0000075
Family Retroviral protease (retropepsin) 0.036
Further Details:      
 
Weak hits

Sequence:  31234.CRE04972
Domain Number - Region: 205-251
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0977
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE04972
Sequence length 1420
Comment (Caenorhabditis remanei)
Sequence
MASSLFIARSVMILKSLESLITEKEVCGNFCDDFGSVFSINNAVIKLEESYRGEQVESRS
ISLCACVSTAILYKSWKEFKTNLVPGEISILLTMSSVTSRSRHSSVSTEMSYRGDENNSK
SPRRSMSVNSAKDVFRDAEAQSFNAGPSAITNGSGRALSFPQIFEPRPDVASTVHQTFGD
RLSGAVLSNVPASAVRNPAIPSEARISCPICSGGHDDYACESPLRSRYCAKNDLCFLCTS
ESHKTQECPLNYLEISKNVVNISLKPGATIGDKIKCSGNPSSESTEQTQSVVDSEKDYRY
LSYHDLVTVLPQFNADPIKYGKFARCFDRLVMKNPRLDHLLKLSLLETKLVGKAKRFIVD
LIDPRAALEATFKALRDEFEEDNYSVVNEIRARFENLTFHETDYKRATLELQDCKSLILQ
LEELKEDVSSTSFVRELSRKLPREAFKRLRSLNANGQTPTTEQVIETFSEYLKENRFYER
FCPWVQEDSSKIHEESVMITIEGSTSPPPRRSGKKRNSKKFSRGAGFNTDATAMPEYSHV
SSSSTKNRKTKGKGKKNSSGAKNQKPLVSSVAGAETKRQEFANYGRIVTAPLTPSKELGR
QLAHSSKARQDSEFSQSNNQNRVSEAHLKSETSLIPLDSVKTVSNRVSRSMKKVLDDPLS
HRARSKLLPQTLVNEFYEASGVKEEKDCSHLPFLALRTTKGKVVLALVDTGASCSFVSQT
CAKRLGLSPIGYRTAVIKGVSTTTTERMSMYRLSFATTGNPVEFFVSGRSRFPETKFFRP
RFGATDNDFLRERYIDPKVITKDRASNGRALEMIIGNDMLARILGNSIRALLPSGRYVEF
TPFGSIIFPAPRVIQFNPLIVSTATSRFHPANSISLVDPNPGNIDRAPSSPQVQSGSTDN
NDGSIAVRRSRQIANLDLSLISKNHHGIRGRNFVSQQGNCNTIGLGNPRHGTVNRQTKGE
KPRMLKCTEEIFLLDASDGSSTIRYMEPRKTQEKDMMKCSLMEEHRVTTEFQRVSVGNRV
FECILKEFKICTNPEVMSHERSFDYFDSLAVYPRDNNLVLEQVELSKDYRGFHPQYYNGK
RSLLSENQFQTGISDRKEVIQKVHRVREKLDNGRTHVLKYQYLDAGRSGASLVRDLTASP
APDACRSGTSEEGVLRKLTSMDACRSGAPKGRKFITTDNSGQTSDKYAASSDPPGRRVGL
KSYCFVPTIESFDTVSDVAASRSGAARGGIECLTPVPDVCRSDTPGKGFNRAVPNLDAGR
SDASTKESDESAPNLGIRQSSSHRRRFGLKSYCFVPTIESYDTVSDVVAGRSDTTPKDTK
QFNPTLGACRSGASKSKDDQKSSGSEYSPNVKLRRPRTIDDWAKIRLPTHRVRPYQPRKP
KAKLARYVLITQAAEPQTPRSVDSCQVPDQASVTLQTKMH
Download sequence
Identical sequences E3MN94
31234.CRE04972 CRE04972 XP_003102416.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]