SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE05211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE05211
Domain Number 1 Region: 1817-1991
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-33
Family Protein kinases, catalytic subunit 0.00059
Further Details:      
 
Domain Number 2 Region: 2399-2496
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000195
Family Retroviral protease (retropepsin) 0.01
Further Details:      
 
Domain Number 3 Region: 1469-1567
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000873
Family Retroviral protease (retropepsin) 0.028
Further Details:      
 
Domain Number 4 Region: 1159-1228
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 0.000000968
Family Glycoprotein B-like 0.0089
Further Details:      
 
Weak hits

Sequence:  31234.CRE05211
Domain Number - Region: 2332-2376
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00272
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Domain Number - Region: 1374-1464
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.00785
Family ABC transporter transmembrane region 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE05211
Sequence length 2697
Comment (Caenorhabditis remanei)
Sequence
MQRKQVDYTTGAGGLDNWRRWTKEGKGDHNHAPNPTRARRRPIHSTIHSVTRHTNCALLP
PNQTSISNLKTPCPNFPLCYCIPSSKETDTPRTTTPKIGPFKRFNWRKPTGSSDRVLRSH
SKVVQGRTSSPLPGHYPPPLNFEEDLNESKPEFTPNQTVLFTEETRRELQDKRERFQKTP
TPENGEENLLRESPPNDTLFRTAIFNPQIGEKLGNGENLGDRTLTPGQIPKLQSESSEFT
PDQTLLFNAETRREMANRRVPTWKEQGEMTKILDRRISKFNDGKSSELKEWLDQFSRALH
RCHIAPEEAVELIPLYLSGPALLKYNRLDEKKMTSWEEAAKMLIEAHDCPAEKEVALQEL
TTISQGKKPLSAFGQQIRTLGNYAYDGLNSESKEQLMATHFLTGTSKKIRTRLRRLQTIP
KTLSGMQSEAEKIQRLLQIEEEEEEEDNLIAAVQRLNLQKPQRNDRRENEKGNTSGNPQW
NQQGNNHGNSGNPQWNQNPNNQENPGNNWNQNCQCQCNPQNGGGNQNPNNQGNWSQNRNS
NQGNSGRTQNSNQGRQLRWDQNTGRPYVNNIGHFLMGIATILTLIMAPTTEANPQICGFG
EAGNVFIPPRPILCTFKQDIALKDHRVNVYSLRHEAIQMETIKCFKHEVTGERFSFLMIY
KSTEATVGKRSPVSQEECRRASISKKYNDLEMKEISPGIFRTEATQDIASNHTLWLGTSV
FTTYEFTLEVGQIATIDGQHAISNLGDLESCNFSTGNCQDDSSTIIWQAVDTRKECQYEF
LQSATALISQQQIAIEEMGIFSNIDGDLRRLQSAAEGCFVHQPYLTDDGYLVEFYEAPLT
GWVPDMHVESSPERRRPRLWNRGPREVGSIGGHGGMEFQFELGENYSTPILKKLFGTNNW
TEIPELKNPISEPALLREISRYNISNTLLQNRARFYPVDRRAENPLLLMTLKAIRIGQYG
ARQLKELNEMEHQLTKGEEQLKTLIERQDAHVFNKLLEREFGISNPVFTQGDDSFEPPKI
LPESLVQYQGLKPEEEAIWRMPTTPLPKTTTTTTTTTVIPTTTTTVKRKPTNPITTTKGT
STTTTTPPTKPSSTTKVKSLETSPRPTVQTTKEKPQVQLEDRDPIPEENVNVVYEQPDIP
QPKPHNEMQVLLEKPKEQVFREVCQEQWRTTSMFETVLQIDPTAAIRQLLRRSDISAKRI
GETLLISKCQTVSPDRIHWDRKVNTTCFDLIPVTVKDKVWFFLPGSQDLVAEAMEIPCEE
RPPSVRWEHNRWVGLKNQEVQPQHLTRPNKREQQHFILKAPDTFYTILGEENGVSTGADK
EQSRRLGKRLVTEGILKETIEKISNSTSAAGRSARKMYESAMGKLRDGLKMAVFEILVLI
LWIAIPLSTIVLILGVLYVYIKYKTIKRTRKLGRRTMRQARNALVEYAHNQIARVNNVEL
ERSTRRPLRSYREEYTTFSVNSVKVNAVNAARLPHIDVELDGETLEALVDTGAAISYLPL
SSVKSKINNRNTPSARAANGSSINFLGAYKGTIKIGNFSIPHEWLVSKNSECPAPMLIGS
DLIKKIQQPRTWIEHQPPQKHHPNRQHVPRKSITETSPFSLLELRDEAQLRRGDVTRRGL
LGKKKNATSKDPQKIKMIQKMVEIGGDSVLLENRNGQCLLYEIRRMNKPRWTIVSKEPSL
SINVTSLYVCLETHKNTVRVVRISSGQELPWITMRKNDSFCGIWREMRDGMLTSEKECHC
IPISPIKRHQIILFGTVEVSLLRKNNKCQIKVENRDRRLKGALEENQRYESNFFKVKKKH
EDEGDVKSVVFQIVSDGPKIDDFEHNGDVGQGTYGLVGEYRSKRTRHRVLRHVQTLNRSL
RYIEAYLIQRETINMAKISHRNVVHLYQCFSTQLHVYLVMEMMTTNLSNIIDSSGRLDKS
DASQVLKSVGEALSYCHFKRLIHCDVKPENISISHEAVKLGDFGVSTFNEGRALCGTGYT
APKMFTDATHSFYICYIREDIETWPSTLVHVLYLLNLLFPMEIRSLENHERLKKRTTNRP
LKTPKDKTMVEEAQGMNVHISMDEVLKALADGRLKLTTKTTEGAGSGLVDSISRRIANFE
YEPEEGQAFEDWYLRYGDTITGEGTDLSDEAKRRLILSKLNQRDYNYFTNRILPDKTSEF
KFEEIVNKLKECFPSTRSTFARRMEFLKIIDEGGDLGEYTGRVKKAYADAKFNEMSSEQV
QCLMWIKGIRTNGTVDIRARAMQIMETRPTTTLIQLDHEIMKLLEFREDAKNIGGCRTSE
EVFAVRKMRTEKAKEQKRSSQRHLLRKEKQRENEGSSTDEKDDSDEEKPTRNHNQRKKKC
HRCGGEHNAMNCWAKNKECFDCGRRGHVSKMCQEQQDDDEKSDRLCHRAIYAEDDCYEKT
RIYRTIEVNGLDVKMQVDTGADISFISREDWKRLRKPKLKRTKTEIFDAGGLKMQLDGTF
KCKIKYQGVEKTVEAYVGDAKSLFGLDWLKKIPDVLNIEKIWMNHIVAKTPNRRRDIYKV
NGIYVKESKPRKGSTEVVKNGSMKRHVRRWPDEKFVKIQRNREETGKERCKSFVTRSPNP
GRKEKVGAFERHDRWEKKNPKENSRLQPELKVSFPETLGQHSAWSRGWNQQGSSAPSLPI
PPQTSFAMYPWRNNFGCSEMTGCYVWIPNCYEMRMMSGPDANWRGFHQNDVAPVDFR
Download sequence
Identical sequences E3NEA4
XP_003093284.1.11157 31234.CRE05211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]