SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE05336 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE05336
Domain Number 1 Region: 120-157
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000384
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE05336
Sequence length 362
Comment (Caenorhabditis remanei)
Sequence
MNSLLSVVLIFSVAVMMAAGSSISSNVDSSKLCNKILCEVNATWKSEQNGDCFESTYHKK
TYKSTHNGTVDPLVGVADCTKTLCGVTEKVKSDCPAAFGEKWDEFVNKPVLNNSLTARSH
KRNSGDQDEIRTHAGKPCFDCGRRGHISKKCREQQDDEKSDRSGHRVNHVVAKTPRRRRD
IYKVNGIYVKESKPRKGSTEVVKNGSRKRHVRRWPDEKFVKIQKNREETGTERCKSFVTR
SPNPSRKENIGVFERHDRWGKKNPKENSRLQPELKVSFPETMRQHSAWNRGWKQQGSSTP
TLPIPPQSSFAMYPWRNNFGCSEVTGRYVWIPNCYELRMMSGRDANWREFHQNDVAPVDF
RC
Download sequence
Identical sequences E3NS17
CRE05336 31234.CRE05336 XP_003088802.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]