SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE05676 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE05676
Domain Number - Region: 634-689
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00445
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Domain Number - Region: 689-719
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 0.0706
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE05676
Sequence length 745
Comment (Caenorhabditis remanei)
Sequence
MYKGLTDFKRKVTLQTNKGASEAAEAEVFLNELRDTATILEIVRRREAVLLKRDLIASFE
NEAETMLREDHVMNETEATVREFGREMREHMEKHRCKDIADQLTEYAERLQLLMEVRESE
VVRRRAVSANDGAPPLYDLPSNQGESSNQGPTFGMEQGPPPYDDIAERAMPPSTVVRRPT
VTTQPLFPRRQEEESTRNGNVLGSAQSMDITNARRIEDHATDTRFTAIESTQQSLMETLN
VIRDTITALNDNATRTRSATEERLQQIQQVLRGIGQNPAQSERDRCNIPLARSQVDLIPQ
LPTQPTMRGQTHREAISQMNGARRDLVTQPQYTEPSSRGSYTSNSLHVMGSNPEEIKLNI
KLDQMKASATTAVLATMKPFSGEVYEYTTFIGQFECLVQNNRSIDYPMKQAILIKLLPDH
LALEHQTPQMNEDNYWTIRQNLDRQFNRQGNQVVAILQKIEETTFPQHDLDLLKGSLNSF
ANQASKLRPFGFNTNDPYFMFNFVRKLPEKIRRVTQTVLQRGNTTFNELMNIAQEWVSTE
QSLSFGGGRRLGGYDQSYTAAINQVSSSGGPGQQQLQDNNEHRAMQGRTRSESCGDDFNT
AVNQVSSSRGNGQQPHQRPESGKHTVSKYKRWTRFNPPSKTKPCRYCDDASHSASECIVP
VEEKTKAVIAKSLCHNCLSEKHRIMSCRSKYSCFNCNKRHFTGHCPHLKKDDVMINQVGL
LCNYEDDEELEKQLFRGDGAETPEF
Download sequence
Identical sequences E3M0P7
XP_003110569.1.11157 CRE05676 31234.CRE05676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]