SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE05677 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE05677
Domain Number - Region: 299-340
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000349
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 
Domain Number - Region: 126-260
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.00445
Family Apolipophorin-III 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE05677
Sequence length 396
Comment (Caenorhabditis remanei)
Sequence
MTEESRKGHGDSQGSNDVKEDENEATSTRHIDRFAKNSRRRGGQRDFIEEWSHRNLLDGR
KDHSKIELTEGPKSRMSQDSILENEVVTDEDIESIVHDETTLLETEPEITSKSLIPIGES
DVRASRREDDQSLKNSKDRNEMMAEAQKQEDVKEAVNAFMRSIDDRIESSSSKSSKKLKE
AKKKLEEAVDQYKAGKSSEAEAKFLRNIIRYQSAAQQVLTETIEEELEDQSKLIDEVMTA
SEELAKKNEELVQKLKEMKTEAQEKDRPACFFCESTKHSAIVCYQFKDHEERTNMLIAED
KCLLCFQKGHKKNECADLARYENCKKCKQEKHHVSICPKYATKERTEMKQGRGLNQKEED
KQGEMSGRHMEDGKDLDGPKQSASEAKKQRQPILPP
Download sequence
Identical sequences E3M0P8
31234.CRE05677 XP_003110602.1.11157 CRE05677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]