SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE06222 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE06222
Domain Number 1 Region: 470-896
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.1e-123
Family Reverse transcriptase 0.0000912
Further Details:      
 
Domain Number 2 Region: 1076-1230
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.68e-41
Family Retroviral integrase, catalytic domain 0.004
Further Details:      
 
Domain Number 3 Region: 328-422
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000598
Family Retroviral protease (retropepsin) 0.0097
Further Details:      
 
Weak hits

Sequence:  31234.CRE06222
Domain Number - Region: 267-309
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000942
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE06222
Sequence length 1388
Comment (Caenorhabditis remanei)
Sequence
MADTTTGDQIKQLTEQINALVGVVSTLAKNQAQLQNSGNTEASTTTTNDTKMFDSICARI
PMFVYDAEEEKTFDNWYTRYEEVIIKDGASLAEDLKTRIILSKLCQKDYALYTNRCLPKL
PNEISYTDTIKSLKTLFKSTTSIFRKRQEFLRTEFGGGSLEEYTGTVLRRFATSEFKKMT
DEQTCAMVWIAGMRDPSYQDIRARALQVLEQKPNLTLLELESDVKRLLDIRADARAVGGS
VTTTSDVNAVQKFQKSKKNTPEKKDSKQPPSACYRCGGNHWVRDCEHKKVTCSYCKKPGH
LEKCCRSKNRENKSPKVKTVYIGAASIDGAERIYRQVQINGHYVKMLLDTGADITLLSRN
DWTTLGRPRLEKPAIKVKSATHEPVKIFGSLHCKYMMNGRQESGVAFVSNTDTLLGRDWI
SKDKELWKFLQNSEKINRVSVTEPACNYLGGTRERLIEAIGTKYKEIMKPGLGKCTKTKA
TLTLKPNARAIFRKARPVTYSALPMVSTEIERLNQTGVISPVDHSEWAAPVVAVKKKNGS
IRLCADFSTGLNDAIESNNHPLPTADDIFAKLNGGNFFTQIDLAEAYLQVEMDPDSQKLL
VINTHLGLFTYNRLPFGVKSAPGIFQQIMDTMLNGLEGVSTYLDDIIICGSTIEEHNERV
LKVFGRIQEYGFRIKMEKCSFLMEEIKFLGFIINKQGRRPDPEKVRHIKNMPEPTNVSQV
KSFLGLIQFYGQFVKQLFRLRQPLDNLTAKDTDFKWNRECQKSFDTIKEILQSDLLLTHY
NPNLPIIVAADASQYGIGATISHRFPDGTEKTIYHISKTLSKTQRNYSQIEKEGFGLITA
VTKFHKFIHGRKFTLRTDHKPLLTIFGGKKGVPVYTANRLQRWATILLNYDFDIEYINTK
DFGQVDALSRLIDQQNAEKAPEDFVIAQVELDPVDQLSQNLEFLPITAKTISFQTGKDTI
LTDVLNSLKSGKWPKSEKGTEMWNMCNRKDEFSIVNDCIVLGERVVIPTVLRQKVLKTLH
RAHPGIVRMKMLARSYVYWPGIDKDIEKLVKSCDECASAAKNPVKNLLYSWPIPKKPFER
VHVDFAGPVDGMYYLVFVDSLSKWPEVYATTSTTTAATIKILAKVFGQFGNPETLVTDNG
PQFTSQTFQEFTASNGITHVRTPPYHPQSNGQAERFVDTLKRALCKLRGEGNTETALQTF
LQVYRSTPCASVPNNQSPAEAFIGRKMRTVLNLLLPHKPTPNLERNLAMETQFNLHHGAR
DRIFEINDQVYVIDRRSPNSSQWVSGVIERKLGQTVYKVRVGSQRWTRHANQLRQRTSPP
SHYDWSDFLEIEDPAEEMPKPDKADTTTIPVLSPSTSIPPTTPVPLRRSTRNIKPVQPFQ
IQPKQKRY
Download sequence
Identical sequences E3NR77
XP_003089094.1.11157 CRE06222 31234.CRE06222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]