SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE06273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE06273
Domain Number 1 Region: 568-595
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE06273
Sequence length 664
Comment (Caenorhabditis remanei)
Sequence
MVNSEVEEQFRGKKKESKFWEKMNVKLNKTVLSLQNELETKSQQQPPTSLEEPTATCVLS
GQSIQGNDERRKLVSVLEANEIHTEDELNKLFEKYEHLEYELSVKVEYLQRSQRQTDSFR
SELCRLKVKCDQQRQKLLAEEEKVKKMSEELKVKHSTHSANSATRFGECNLQTGEQKEST
RYYNAETSEIIDTIPLQESLDSGRNWNQKIVEQNAQRNIIVHSEQGMPNMNAQWRMAQAL
PDPPVFSAGKNSVTAETFERAFYMKYRFFDIEAQKNFLETKFLSGNALTVYKGLPEADKN
SVSRILDAIKRRLSQSEPEESRRAKSKFQALKLHKEQTVQDFCLIMDEVVRIGYKGVPEY
QISSMKTTKLLDEMREHSVFEVLLQILGSQLRNCPVEEQYELCRVEATMFDEEWRSGKRK
ATQHEKRMNREHSDQYSNNVPRTGFTQNNASIPQQSSRFNRYTPNRQSNSYQTNSGTDSN
GNQCTSTTGQQQNFSTSNDLNNQCAPKGYMYNEKSPECWKNLAHSSDSANNASSNALGFH
KCSECNLTGCHAPTCSRAPGSNTSKVKINSNIVCFRCDQQGHIASKCPTRNTLLQEVRVA
PEIQSKVEDQKFKMKSDTKCSSDKESERELIDHEMETKDLCEGQSVAASVFKKDMVIGCG
QSAN
Download sequence
Identical sequences E3NVU4
CRE06273 XP_003087477.1.11157 31234.CRE06273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]