SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE06628 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE06628
Domain Number 1 Region: 561-591
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000124
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 
Domain Number 2 Region: 615-715
Classification Level Classification E-value
Superfamily Acid proteases 0.0000863
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE06628
Sequence length 1203
Comment (Caenorhabditis remanei)
Sequence
MRRTSFANPILIRHNNQSLTTTIVDPTKLAEHSKRRMEKMETEEAPKAVDEGKGGDDANS
LDGSLWAHVTELESTNVSLKEKMKRIRGFEKFVEKSEEVVQNLQKALGDTTLAARKQDLM
LAPVEKYCAELRERYGEVRCDGWQEKVLKLMREKAVETVEQLRDECEKAGDENEEEKEEL
EKENEKLKENNKCFQRLLEEKNVEMADEMARSEAEREQLQKKLEEAEKKIEKLKNAMTKE
KKVAEGLKSSIAHLEGEKMELRKKENERELQENLPRHERTSSLRKEGGRTTSDGWSSGGE
DARSVRSVRSRRSSEEMWESESRASRYSAIEDLVKSMGEVMRSSARASALPTPKVYDGVG
DFREFRRAFLLKYQSVTESDEELVAILESQFLKGPAKSIFSSLKNRHERPIKDLFVEFET
KLRKRQGDAKTEALNVFEGLRRSPNQRMWEYCIEIEKWSKKALGDIGEETMSQMRVTKLM
KAIRQDALLHRVLITKRPEVKLEDQYEVFKDIVLQHENEEFRMSQQRGYFGGGKGRYFGK
EKAESGEKSDDKGDKGVPGGRREMGERRPVDTRKCFNCGGVGHMSKQCTSKGLNEVDAQK
KEDDGSVGKEVVEIAEILGKQKKIIIDSGAVVSVISTGLLGRLRKNWEEKVEMLEKPGLS
LRDASKRKMAVVGQMKTVIRVRGIEAEVVFQIVENELDVFLLGTNAFASMGVEVNWKAEK
AVAVTAQKLRVPPQSCAQIEVRVEADLGEDMLLESTEEWVPTSLCRKENNGKMMVVVSNW
RDQPLLIKKNRPIGVANRDWKLVSEEKESHVVNMMDLDGKEGLKGVERVREVIRVLKENG
EFPDGISKILEECSDVFALRDELTQTRWRIVVETTENSASVQFMGGEEKLWIPWEQLRKV
PKEIVDMKCETSARRGQRGRKKKAVVNVVEQGKLCEGEKENLTLDNVKFYRKSDGEECGC
KRGNAHFVDGYGDRSYDPKNLALKMLAKNEKITPEDVHLMVFDEEFQKKLGKSERLEALR
RFAKICPTWAQKVMTGAVEEFEVEWKEAADSLKKECCRKTSRRSQQSRKAKFDWDQVEKA
VILAEWTRKEQELEGLMHLVEEIAKEVREVVVVPAKMECAFDEVGGVTAQWKKTRKTAVN
VEIVDPLTPVGTKKTPLILSELRSGSLEKIVEYLELAVPSHPVVDRLKEEVTSEPRAKKP
RGQ
Download sequence
Identical sequences E3M1V0
CRE06628 31234.CRE06628 XP_003110133.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]