SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE06785 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE06785
Domain Number 1 Region: 544-699
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.16e-41
Family Retroviral integrase, catalytic domain 0.0044
Further Details:      
 
Domain Number 2 Region: 352-442
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000345
Family Retroviral protease (retropepsin) 0.014
Further Details:      
 
Domain Number 3 Region: 280-324
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000111
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE06785
Sequence length 900
Comment (Caenorhabditis remanei)
Sequence
MSDAEMNRKFIEMMELMQKQMAEQAKKHEETIAVLTKAVAEKSQSDGSLGTSSGLTVSQS
QLMNDIGGRISVFQFDLETEKTFSKWYARYSTAFTEEGKGLDDKNRVALLVSKLSEEVYE
QYSRRICPKLHHEVDFKDTVDILKEMFDIKKSLFSHRFACINIARDGDSPVEYTNKVNAL
CELAMLKDIDPDGWKVFFWLRGLDPTQDTKARAYFLKYVEKKTELGEKVNINELCTEWQK
IQSQTSAVSEMEKSDTAVRAVYAKRPSNQDQSRDKNTSEDGNSEGGKCWNCGKRGHIKPD
CPKPLTTCFDCQKKGHMSSFCRSRKDSSSRKTQHVAIVGGASSEDAEVNSVRQYVSVDVN
SESVEFQLDTGSDITLIGREDWSRIGKPDLERCRSKVKSASGNELKILGRTLVEFRLKES
VGTGYVYVREHGNLLGLDWIGRSKEMSYHMGMMVNELTHSNTDAIHGGLNGKFPEVFKKG
LKRCVKKKAVLKVKENATPVSRSKRSSVQGASRVVEKVVSSCTISQGGKIPRKIPLQPWK
TPERVWQRVHIDYAGPENGQYYLVAVDAKSKWAEVKIVKSISAVSTVGTLKDMFSQHGYP
ETLVSDNGTQFVSKEFATMCQEAGIEHVRSPAFHPQSNGQAERFVDTLKRGLKKLKGEGS
VNTEILSQFLLHYRSTPSNALGGLTPAEVHLGRRLRTRLSLMMPQLNKTVDSEQVAMKEQ
FDKHHGVKARSYRKGDSVFVKVFEKNTWSWKPGKVNQRQGRVVYVIGLNDGRERVVHANQ
MKMRLEESTQEQSKEHEWATTMFDVFELPTVWSARKSTDEAKRDMTPTPVMDSPQRVHQG
QGTSSSPAQQVQSRASTQPSSSQSTTTAVQGQRLAPSPVQPRRTTRVRKNVVKYDPSAHI
Download sequence
Identical sequences E3MNT5
CRE06785 XP_003102186.1.11157 31234.CRE06785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]