SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE06930 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE06930
Domain Number 1 Region: 886-1320
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.78e-134
Family Reverse transcriptase 0.0000278
Further Details:      
 
Domain Number 2 Region: 1511-1664
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.53e-36
Family Retroviral integrase, catalytic domain 0.009
Further Details:      
 
Domain Number 3 Region: 642-745
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000244
Family Retroviral protease (retropepsin) 0.021
Further Details:      
 
Domain Number 4 Region: 498-535
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000118
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Weak hits

Sequence:  31234.CRE06930
Domain Number - Region: 767-855
Classification Level Classification E-value
Superfamily dUTPase-like 0.00501
Family dUTPase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE06930
Sequence length 1869
Comment (Caenorhabditis remanei)
Sequence
MNNPPRIFNRPAVWSVQKSGDRVTDGTKPTIQHFLGLKTSILKDFDRICEGAEELAAEQR
TNLQLVQGQVNRALFEGERTNRLVEALSAKIDELDRKVSEGFWNREVTGVGNGDDHRVIP
PTAAASPRTRSLSLNRGANPQQPYTPVVARHQVTPYHASSNNSELLEDLDNPEASVNGTP
QHFLAAEEDNESILHADLNDTRRYEVYVSTPNNMEENQASSGNTVALTASNGTTPSGGTP
HDDVNNVSGASAGAKAPSDEEEQGDDVVDDSNTGNREDEEDFVPQVMVLSFKSAAPLEMY
GGTTREDFNGFVRAFNDRILAMEAEATDEDKKRAFLTVLKDQARDRAESILTERPNATFD
YIIQGMKEMFVGTSHIQRSKALLRSSKQAPGESADVFFHRISKLARQSYSDNATFQKEVT
LEQFLNGLNPSVKTLVMLRAPTTPEEALGYALSVEGCVTPADQSTSMAQIPELLASLTSM
VIDLQKQNNQRDDARNNRERNYSRDGSSSSQGKCFYCQKSGHYVRECRKKRSDQANGISG
QRPNRSRNPVDNHRVDNRPRTNTVSLENEVQALRSAIKARDDQLEEYQKRHDRTIPDGYY
SGSNASVSMIYWPTPVTEQNPQVQQAVFNQHRIGSERITAQVPIKANGFKCNALFDTGSN
ITIAGDNTRKILRIEQLTKTPFEHACGLGGNQVKMAGYADITFQIGSLSITQRTYFTTGR
CTPGNPRGYDFIFGNDLLSRLPMFIFDYANASLHIGKDILPLGTNPPATPSPSQFDIKVA
EETVISPRSERIVKCTIPEEISRTSELTILAVPPRLPSECLFVAPTVMSSNNIAVMITNA
SEEEVTLQSKTKVARGSQLEEDPEFRIDLTKAEGISVEEKAALQALLDTYKDVFSKNAYD
LGSSKTDPVHIYTNTEVPVRGRPYRVPVKYQAELEKHINGLLLSNRITESNTPWTSPIVL
VKKKNGSLRVCLDFRKLNEVTIPDNYPLPRIDTIIEKVGNARYFSSLDMANGYLQLRLDA
ESSYKCGFITENKVYAYTHLPFGLKSAASYFQRALKTVLAGLEEDVMVYIDDVLIYSKTF
EEHLVTLRHVLSRFRQFSLKASPKKCEFVKQSIVFLGHEISGTSYSPNQANVDSIERLPT
PNNVPELKRFIGMAGFFRKFIENFAGIAEPLTRLTRKEQKFVWSEEQQEAWMKLKTALTS
KPILSFPNYEKPFHIFTDASSVAQGAVLMQATDTDPRNFHVIAYVSRTLSDEETRWTAIQ
IELGAIIFALRQFKPYVCLSKIVLHSDHRPLTFLLAKNKVNDNLARWLVELQQYDIEIVH
IEGKKNTVADCLSRAKDEIAPLNNQEMEDIIDFPICMSNRPRRPTESRVLTVTGSSKPIN
LITEQDMDKDISIIKRFLKNPATPIDRLPDEWSDVLDLMQISAKGFLVVVFEGTPRTVIP
RQLRSLIFDSFHTNVMAGGHLNFRKSHQKARRKFFWPNMKSDFFRWYSECVPCQQKRHPH
PSTRQPQSVVITTRIFEKVGVDLAGPLKTTTRLHKYYINIICWFSKFVISVPLPDATAET
VARVILEECVLKYGTPTEIVSDNGPCFSAAAFKQFCTMLSIGHHLAIPHHSRGNGATERT
FRTFHQMTSKYVNPTHTNWDTILPCVTFAYNTAVHSTTGETPFYLMFGRDPTFVIDKILD
PSPSGFTDEDVRDWATHITTTLRQAWKDAAEHSLKVQEQIQARANDGAKGSDIQPGDRVL
MKNYESKAGLSRKLVLPWVGDYRVLEVSENEALIQNLKKPDKAPKRVHLDQIKKLILPAA
TDVRAEPESTVEVKKMFGKTSTKPKSVKITEDVVKPSGTGGQAEPTPTQPPVGRRNPPRM
RNPPKRLGG
Download sequence
Identical sequences E3N6M8
XP_003095971.1.11157 31234.CRE06930 CRE06930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]