SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE07072 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE07072
Domain Number 1 Region: 516-570
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000254
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE07072
Sequence length 624
Comment (Caenorhabditis remanei)
Sequence
MTGDTLFIEQYRGRATKLIKETSECCVDNEVFMANLTKDRKQHSLFERKQLLVDKKKALF
ILQGETSIQEESTRLEMVAHLKSQGFQETTERVQRIIEKINEKLTQEKAQQDQLQKERSL
SDIPADAAIGKSGIVSNPAPQSHAPAGGVNSVAQINAIEHGNKEMRQHHANYSTNVPIAR
TVRKECWNPSYSDESRGRRDPSFQNQGCPETTTTRGEGDSLQVANQNFRDKQQRRRGSDD
CFNQGGKHSKEQFYPRIETSVQRYYMPQQERQVSMEELKCRIAKAQMNATIIQSLMATLK
PFDGQPHEFQAFMAQFDSMVHENKYIDAKMKQTILFKLLTEEVARLHNPTEYSPKGYWIL
REGLIKQFGNPDRQMFELLKQIHFTPFPSNDLAQLINHLHMTRVYARKLMMFGVNPSDPS
FQFIFAYKLPQPFKEQAFELMARRIYTFDELVQRTLETVEFKHRMEENQMEKSHTDTILY
RKSNNIQENQVSGRRSPSCLSQAQRLQQPEAHRTSTFTPPSRTTPCRYCDDKGHAAVDCS
SSLKKKLEAVTRKALCFNCLSKSHGVFTCQSRFNCSSCDKRHFTGHCPDISKDGRIVATD
SDASDDKGNRDQLSRKEKDENPKL
Download sequence
Identical sequences E3NJG3
31234.CRE07072 CRE07072 XP_003091458.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]