SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE07075 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE07075
Domain Number 1 Region: 272-371
Classification Level Classification E-value
Superfamily Acid proteases 0.000019
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Weak hits

Sequence:  31234.CRE07075
Domain Number - Region: 212-246
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000293
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE07075
Sequence length 655
Comment (Caenorhabditis remanei)
Sequence
MVASMGRMMKASALPEPKTFDGTGDFKEFKRAFLLKYQQVTDEDDELVAILEERYLKGAA
KSLFKSLGDRQERPIAEVFVEFERKLRKRQGDAKAEALHEFDRLQRAPEQKLWEYLVEVE
KWSKKAYPEVEKATLSQMRTTKLMRATEDDDMLQSVLVAKRLELPLAAQYDQLKDIVLQR
ENEKLRKQKERMGRLRDQGNSDGRRSPEGSNDGDRKTVGERRDSGAKMKCFTCGGIGHGS
WQCISKRVDKVQIQEGTVENAGVETVEMVEMLGQRRRVVIDSGAVVSVISTSAYERLKAG
CRDWEKEVEVFGKPTFTVLNASNSKMRVRGQIKVPMVVRGRKVRVVFQLVENWVEKILIG
TNAFESIGVELKWKDPYGLVNAEENSAEGQFIGGEKKLERPGEKLRKVPTEVSEIQCKSV
AVRGERGRSASTGDVGEVFKSEGEKERKKVKIRVAVIGPRLEARGPGVLEYRNKTITGWT
QKFDWGEVKEAVVLVEYTDKEDENSKRVEFVKSVAKEVEKVWMMPRSLQCELGDVDKVAK
QWKEWLKTSANVEVVDPLMPVGNHKTPLILEKWHRKSLNGLQKYLHNALPSHSVRCQWEK
NTDRRPQSGLKKDLGKGCPIAERRGKWLRRSSTFSKPHGITEVKGNEYSRGNRKT
Download sequence
Identical sequences E3NJG9
CRE07075 31234.CRE07075 XP_003091457.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]