SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE07098 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE07098
Domain Number - Region: 90-187
Classification Level Classification E-value
Superfamily t-snare proteins 0.00683
Family t-snare proteins 0.02
Further Details:      
 
Domain Number - Region: 231-262
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0181
Family Retrovirus zinc finger-like domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE07098
Sequence length 374
Comment (Caenorhabditis remanei)
Sequence
MGRRSNTKSDEKSDDNSAATSVKILKRAPNGEHSQETLPAVEGDDSNKENNIVISPKRQK
TALVPEVQQEEVVMILSDEPEQTSMDHDHWWQDYCSEVMNLRKDVAESNEKLQSLIEMKQ
TDGIPDFITEVADLAGKVDEGMTALSDHKAIVETAMNLNSTLLAKYDQLAQNFSTLAKAQ
QKWVEEQDHAKKFNSIIELISPLHEKINTIGTFVSGVVAASQRPLTDGKERDPSRIPLKK
KYCVFCDKLTHTSEECKTVTGYDDRRAMAKQKNICVKCIGQYKEEGQGHVNCPQQNIVCP
RCSAKVENKAMSAHSETFCFLKKEQNTAKDRPNAPPRNGLYQVKHAKDSSHENEMFQKRS
WDPKQYASTSDKRH
Download sequence
Identical sequences E3NM51
XP_003090521.1.11157 CRE07098 31234.CRE07098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]