SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE07164 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE07164
Domain Number 1 Region: 92-152
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 5.04e-18
Family VPS23 C-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  31234.CRE07164
Domain Number - Region: 20-127
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0183
Family MW0975(SA0943)-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE07164
Sequence length 157
Comment (Caenorhabditis remanei)
Sequence
MSAVEEKLKAKLRERMGTNSAEMASIRTTSDELREGQQKLKKMLEELETQRNSLQTAVEI
YTVKKTELAKALSDAGGTDAPPIDEAIDAAYPLHRQIVMNYAKDLTCDDLIYALGQSLKK
RHITTAEYLRRVRDVSREQFIHRATMQKCRRTAGLPI
Download sequence
Identical sequences E3NT14
XP_003088456.1.11157 31234.CRE07164 CRE07164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]