SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE07474 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE07474
Domain Number 1 Region: 730-830
Classification Level Classification E-value
Superfamily Acid proteases 0.00000774
Family Retroviral protease (retropepsin) 0.024
Further Details:      
 
Domain Number 2 Region: 684-708
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000126
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE07474
Sequence length 1058
Comment (Caenorhabditis remanei)
Sequence
MRGCSSIVQTTSLFDNGIWSSIVDLGKCDPTNPVPKEIFVESRENGTGYRQDLVLGWEIM
APKFTITATRPYFTRDTEDVILMVDGDGIAHGNVSICLESISEKNNVMRTKEVKVSSKIG
DALKIGIPNEWRNDVSVIRVVAKRKIKNGYSNETMLYIPNLSSTTLQSSLINPEEIKSFY
RDDEIMNIRVANTGKEMNFVMSDKTSSKQSTLKVDDDRMIVVETQMSVKERRKKVKKFTK
LIASIVEVEDETRLQFEELTTKCSETEVDAILEPMRIFHRELLEKFEEIGGDEWPRSVIR
VMREFKLESVEELREACAKAAESEEAEWSVGKVNLELQQVQYEMKVLTECWKEEKEMLGE
QIREIQREKEMLGEQIRKSQREKEVAEAQVSRLEKALKQLRKTVERQERKPNGLWDEVQG
SRSSYEKVVNWDSESTNEGSRKKGGEDAFSRKTLSRSGISEVNEMVQCMNRMLKSSALPE
PKTFDGTGEFKEFKRAFLLKYNHVTESDDELVAILEEKFLEGAAKSLFKTLPKRYERSIQ
SLFEEFEHKLRKRQGDSKIEALNEFEGLEKRSDQKMWEYLVEVEKWSRMAFPEVKQETLS
QMRTTKLMKAARADETLHKMLIMKRFELSLEEQYDHLKDIVLQQENEQRRGNCQKSPYSE
GWKERPKAENDGEKNVAEKESGENRYWMEQRCFSCGGVGHLARQCPPKPVQSVEVRGKGE
GVGIVAVETVMMLGQERKMVIDSGAAVSVMSTGAWDGLKKGCRNWVEVVKRFRKPSFEVI
DTSKKKMRIIQQIEVPIQVRDRKAEVVFQIVENDAEIMLLGTNAFESIGVSVEWKQERTD
VQQKKGKRDATSSEEKKVFIVGNLGIRVENTKPSGKTAERSKEIAVDTVTEEKKEGMKPK
KTVIRESKILITPRIGVKGKSIFEYRKSALNTWKDKFEFANVESIVFLLELTEDEETNQK
LGDLVRKLTEEGKEITIIPYKMDCAKSGLVESWKRSWITAGNVKWSDSAASAGEKFKTWE
QLLEFLEARTTENMVVAQLRKESVTSEPRKKENKWSHH
Download sequence
Identical sequences E3M2Q8
XP_003109693.1.11157 CRE07474 31234.CRE07474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]