SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE07668 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE07668
Domain Number 1 Region: 495-595
Classification Level Classification E-value
Superfamily Acid proteases 0.0000151
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 
Weak hits

Sequence:  31234.CRE07668
Domain Number - Region: 447-472
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00134
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE07668
Sequence length 823
Comment (Caenorhabditis remanei)
Sequence
MSDKTTLKQSTLKVDDDRMIVVETQMSVKERRKKVKKFTKLIASSVKVEDETRLQLGELT
AKCSEEEADAILEPMRIFHRELLEKFEEIGGDEWPRSVIRVMREFKLESVEELREACANA
AQVQVEKNLLTECWNEEKEMLGEQIRKFQREKEVAEAQVSKLEKALKQLRKKLEQEERKP
KGLWDEAQGSKSWYERVENWDFERSRKRGGEDAFSRKTSSQSGSSEVNDMVQCMNRMLKS
SALPEPKTFDGTGEFKEFKRAFLLKYNHVTESDDELVAILEEKFLKGAAKSLFKTLPKRF
ERSIQSLFEEFEQKLRKRQGDSKIEALNEFEGLEKRSDQKMWEYLVEVEKWSRKAFPEVK
QETLSQMRTTKLMKAVRGDETLHKMLIMKRFELSLEEQYDHLKDIVLQQENEQRRGNCQK
SGYSEGWKERLKAENDGEKDVAEKESGENRYWREQKCFSCAGVGHLAHQCSPKPVQSVEV
RGKGEGVGIVAVETVMMLGQDRKVVIDSGAAVSVMSTGAWNGLKKGCRNWMEVVKRLGKP
SFEVIDTSKKKMRIIQQIEVPIQVRDRKAEVVFQLVENDAEIMLLGTNAFESIGVSVKWK
QERTDVQQKKGKRDATSSEEKKVFMVGNLGIRVENTKPSGKTAERSKEIAVDTVTEEKKE
GMKPKKTVIRESKILITPRIGVKGKSIFEYRKSALDTWKNRFDFANVESIVFLLELTEDE
ETNQKLGNLVRKLAEEVKEITIIPYKMDWAKSGLVESWKRSWITAGHVKWSDSAASADEK
FKTWEQLLEFLEARTTENVVVAQLRKESVTSEPRINEDKWSHH
Download sequence
Identical sequences E3MZS1
31234.CRE07668 CRE07668 XP_003098332.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]