SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE07870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE07870
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.14e-30
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.017
Further Details:      
 
Domain Number 2 Region: 153-183
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000837
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE07870
Sequence length 236
Comment (Caenorhabditis remanei)
Sequence
MLISYLQNCDPPVLPRLQEDFRSDNDEKRLVENWDTSYAQVESQLLETWPKNKESCAQLL
IGYFDYYSRFDFRNFVVQCRREMILSKMEKDWPRPLCVEDPFDLHHNLSSGITKKMFVFI
MKVFINSRAVFMSEKPTVARDFNFVRNYQDQLLRKCHQGSAPSDRQCHNCHRIGHFFESC
PLKPIKDARRRYGSNSTNSSYRSNEGYRNYRATSDDSTPAGGDRLISHKRVKLCTF
Download sequence
Identical sequences E3NK59
31234.CRE07870 XP_003091212.1.11157 CRE07870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]