SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08009
Domain Number 1 Region: 356-450
Classification Level Classification E-value
Superfamily Acid proteases 5.63e-16
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Domain Number 2 Region: 282-321
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000628
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 
Domain Number 3 Region: 503-543
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000196
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08009
Sequence length 661
Comment (Caenorhabditis remanei)
Sequence
MGKPSGGKEVKTEDVLGGIMQQLTLLNERSEQLMEENRELRAEQRAVAGRSSEKSNARLM
AELSKRIPKFSYSLSEPDSFKRWIARNELIFTEDGADLTERERTRLLIGCLEEATYQRYI
DAQRDETDVFDIGYENTVKALHKVFGGHRSMMIRRQKCLEISRSSGMYGDPLEYTNSVGE
AVMEAKLSSMTSDDWSIFLFLRGLDMPGDAKAKVWLMQFVEQSEKNGQKLKLADVHDEWC
RFMQLKVQTEVVSSTTANPHGEVNVCAIENREERRSEHRTSSYRGGFRGRRENFGNRVLT
CYACGEPGHFSYECPKRTSERNRSDSRNVNKKEPESRKVNTITIQTIQVDGVTTEGQTRP
RMMVKVEDKMLEFHLDTGSQITLISEKSWKELGSPSLSEVPFKVACANRTELVVKGRVSV
KFELKGVTYSDYVYVTNRDMNLIGMSWLCKSPEIEAVLKDMVANSKIEEVEEGEQTSWTS
QSSQRVNQVREMSESEKNSKIVERKGCFRCGGRHVPGRCWAEKKKCYQCGERGHIAKRCQ
SEKMFWNGGNEKMRGRLSHEEKEKFGRREANGENFHGVCPLKVNIPGSAWNNRSAAGSRS
WRDTGYGVGRMRPRGPSMRNNYWLPSHDNDGWFYMSGRKLRWILEEKSNRANFSYCGGGV
V
Download sequence
Identical sequences E3M3S8
CRE08009 XP_003109323.1.11157 31234.CRE08009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]