SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08037 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08037
Domain Number 1 Region: 356-450
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000116
Family Retroviral protease (retropepsin) 0.016
Further Details:      
 
Domain Number 2 Region: 282-318
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000767
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 
Domain Number 3 Region: 503-543
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000198
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08037
Sequence length 661
Comment (Caenorhabditis remanei)
Sequence
MGKPSGGKEVKTEDVLGGIMQQLTLLNERSEQLMEENRELRTEQRAVAGRSSEKSNARLM
AELSKRIPKFSYSLSEPDSFKRWIARNELIFTEDGADLTERERTRLLIGCLEEATYQRYI
DAHRDETDVFDIGYENTVKALHKVFGGHRSMMIRRQKCLEISRSSGMYEDPLEYTNSVGE
AVMEAKLSSMTSDDWSIFLFLRGLDMPGDAKAKVWLMQFVEQSEKNGQKLKLADVHDEWC
RFMQLKVQTEVVSSTTANPHGEVNVCAIENREERRSEHRTSSYRGGFRGRRENFGNRVLT
CYACGEPGHYSYECPKRTCERNRSDSRNVNKKEPESRKVNTITIQTIQVDGVTTEGQTRP
RMMVKVEDKMLEFHLDTGSQITLISEKSWKELGSPSLSEVPFKVACANRTELVVKGRVSV
KFELKGDTYSDYVYVTNRDMNLIGMSWLCKSPEIEAVLKDMVANSKTEEVEEGEQTSWTS
QSSQRVNQVREMSESEKNSKIVERKGCFRCGGRHVPERCWAEKKECYQCGERGHIAKRCQ
SEKMFWNGGNEKMRGRLSHEEKEKFGRREANGENFHGVCPLKVNIPGSAWNNRSAAGNRS
WRDTGYGVGRMRPRGPSMRNNYWLPSHDNDGWFYMSGRKLRWILEEKSNRANFSYCGGGV
V
Download sequence
Identical sequences E3M3Y0
XP_003109175.1.11157 31234.CRE08037 CRE08037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]