SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08141 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08141
Domain Number 1 Region: 32-76,125-146
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000581
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08141
Sequence length 156
Comment (Caenorhabditis remanei)
Sequence
MKMNEEDDEDLKKSVEEDILKAFLEEDFKSQHYDSIWECLQHNRRAIAVNGFIIVFLIVY
TTIGGFIFLNFEFEYQQYMKQNATLEKRLCIESLLNRDNRLRLTRASDVAAAIAERCLTE
KVKDDRMQWSFKSAALYSLGILTTLGKNCLFFVRKS
Download sequence
Identical sequences E3M3N0
31234.CRE08141 XP_003109364.1.11157 CRE08141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]