SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08334
Domain Number 1 Region: 543-642
Classification Level Classification E-value
Superfamily Acid proteases 0.0000222
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Weak hits

Sequence:  31234.CRE08334
Domain Number - Region: 483-517
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000419
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08334
Sequence length 929
Comment (Caenorhabditis remanei)
Sequence
MSFSTERTKKRSSSVTSSEKSWAVQMNEVRLKERRKLVKGFTDFLESSGRMESDMYEALK
AACKGNERQSEVLVEPVKKYCHELRERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVSGGIVENAKKAQDELALLQDAWNEERETLFRELNKLKEEKRLAEEAVSEYKKTL
KEEREASSELRGLLRKQEREPKKAGQARDTKEVPVPSRLEVVRKWSSRDLDDEFSMHDRR
GEFSDSERSWGEDWKSVRSSRYSAGNEVMMGMVASMGRMMKASALPEPKTFDGTGDFKEF
KRAFLLKYQQVTDEDDELVAILEERYLKGAAKSLFKSLEDRHERPIAELFVEFERKLRKR
QGDAKAEALHEFDRLQRAPGQKLWEYLVEVEKWSKKAYPEVEKATLSQMRTTKLMRATED
DDMLQSVLVAKRLELPLAAQYDQLKDIVLQRENEKLRKQKERMGRLRDQGNSDGRRSPEG
SNDGDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVENAGVETVEMV
EMLGQRRRVVIDSGAVVSVISTSAYERLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVR
GQIKIPMVVRGRKVRVVFQLVDNWVERILIGTNAFESIGVELKWNDPYGLVNAEENSAEV
QFIGGEKKLERPGEKLRKVPTEVSGIQCKSVAVRGERGRRASTGDVGEVFKSEGEEKERK
KVKIRASVAVIGPRLEARGSGVLEYRNKTITGWTQKFDWGAVKEAVVLVEYTDKEDENSK
RVEFVKSVAKEVEKVWMMPRSLQCELGDVGNVAKQWKEWLKTSANVEVVDPLMPVGNHKT
PLILEKWHRKSLDGLQKYLHNALPSHSVRCQWEKNTDRRPQSGLKKDLGKGCPIAERRGK
WLRRSSTFSKPHGITEVKGNEYSRGNRKT
Download sequence
Identical sequences E3MPG4
31234.CRE08334 XP_003101885.1.11157 CRE08334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]