SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08346
Domain Number 1 Region: 512-612
Classification Level Classification E-value
Superfamily Acid proteases 0.00000352
Family Retroviral protease (retropepsin) 0.026
Further Details:      
 
Domain Number 2 Region: 464-489
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000506
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08346
Sequence length 720
Comment (Caenorhabditis remanei)
Sequence
MSDKTSSKQSTSKVDDNRMIVVETQMSVKERRKKVKNFTKLIASSVKVEDETRLQLGELT
TKCSETEVDAILEPMRSFHRELLEKFEEIGGDEWPRSVIRVMREFKLESVEELREACAKA
AESEEAEWSVGKVNLELQKVQYEKNLLTECWNEEKEMLGEQIRKIQREKEVAEAQVSRLE
KALKQLRKTQELEERKPKGLWDEAQGSKSWYERVENWDFERSRKRGGEDAFSRKTSSQSG
SNEVNDMVQCMNRMLKSSALPEPKTFDGTGEFKEFKRAFLLKYNHVTESDDELVAILEEK
FLKGAAKSLFKTLPKRFERSIQSLFEEFEQKLRKRQGDSKIEALNEFEELEKRSDQKMWE
YLVEVEKWSRKAFPEVKQETLSQMRTTKLMKAARADETLHKMLIMKRFELSLEEQYDHLK
DIVLQQENEQRRGNSQKSGNSEGWKERPKAENDGEKDVAEKESEENRYWREQKCFSCGGV
GHLARQCSPKPVQSVEVRGKGEGVGIVAVETVMMLGQERKMVIDSGAAVSVMSTGAWNGL
KKGCRNWVEVVKRLGKPSFEVIDTSKKKMRIIQQFEVPIQVRDRKAEVVFQLVENDAEIM
LLGTNAFESIGVSVEWKQERMDVQQKKAKRDATSSKEKKVFMVGNLGIRVENTKPSEKTA
ERSKEIAVDTVTEEKKEGMKPKKTVIRESKILITPRIGVKGKSIFXXXXSCRWQGTLITL
Download sequence
Identical sequences E3MPJ7
CRE08346 XP_003101977.1.11157 31234.CRE08346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]