SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08387 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08387
Domain Number 1 Region: 641-682
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000236
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08387
Sequence length 927
Comment (Caenorhabditis remanei)
Sequence
MVNCLGYARIFRLERQSNNRQGGEGYAEATQVSHGVGEWADHCVSPPTAVPDLAEVTSPV
IRIKPSGASAESLNPSRNTPETSGISGFGLNTDYIANHLKAIGEIRDLENFADDEDTSVN
QRKYTEEQVETSDEEDFEDGFIPRVMAPSGRATPTLDSYGETSQEDFNGSVRALKGRVAA
IEEEAPDGDKERAFPTMLKDQAGGSLETIPNEDRGRDHNADKVGSMNNPLRNCKPLVPWN
AQKSADSVTDDTKSTIQQLLLMKKETIEDLDMACKAANKLAVEQRINLQLVQRQVDRALF
VAEKLNHPEEALSTKPVYLDRKVSDCGFRNQEVIGVGSGNDHRVIPPTAATTTRTRSLSP
NSGTNTQHPYTHVVVRHQVPSFLMASHSNNLLQDLESEDESQEEVNRTCPTGPKDGARDE
EDFDEGFIPQVMVLSFGTSLPLESYGGTTREGFNGFVRAFNDRILAMDADPSDEGKKRVF
LTALKDQARDRAESILMDNPNATFKDIVQGMKAIFMDTSHRQRSKALLPSSKQVTGESTE
SFVHRISKPARQSHSDNATFQKKETLEKSLNGQNPDIKSLVMPNTPATPEEAPSDAVSVD
GCATPADQPAPNAQLPAELIASPTNIVIDCKDRVRQRNVSRNDRRQDRNRGGNGSPKRKC
YYCLKTGHFVRECRQKREDRENRIITQRSNRDWDPRHNHQVDVNAVGRDDEVKALRDAIQ
ARDEQIEKLSKQLGRISQGSHYSTSGSSTSEARHLRSTYDPPGNPSADSLFHKALKLTML
AYHEHRKDSEYLNEITLERFLEGLNQSIKRLAIRETPSTTDQTPDTAREGEACLVPSEQQ
PELALLSTQLAASLTNTATDHEDQGYCRDFRSEQQDRDDDFRGRSSENDSQTPERQQQLH
EQGPYKSSRPTKRHGPMDNIWSKFNLV
Download sequence
Identical sequences E3MPH1
31234.CRE08387 XP_003101899.1.11157 CRE08387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]