SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08564 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08564
Domain Number 1 Region: 463-827
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.89e-96
Family Reverse transcriptase 0.00026
Further Details:      
 
Domain Number 2 Region: 1007-1161
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.64e-39
Family Retroviral integrase, catalytic domain 0.0054
Further Details:      
 
Domain Number 3 Region: 326-421
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000285
Family Retroviral protease (retropepsin) 0.015
Further Details:      
 
Domain Number 4 Region: 257-302
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000288
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08564
Sequence length 1327
Comment (Caenorhabditis remanei)
Sequence
MATVEEQLATLTQAVAQLVEYQATQARAQANAQTPAVTSGAPRLFDQIANRIPQFQYDPE
MEKIFETWYSRYKDVINKDGQTLSDEEKTRIVLSKISDSDYLFYSNRLLPKLPTDYNYSE
TVNKLKETFKSTSSIFKKRQEFLRLEYDGTKLEEYTGMVLRKFTAAEFKKMTDDQVCCMV
WISGLRDEKLSDMRTKALQTMEQKPNITLLELEAEVKRLLDVRADSMVITAPSTGINLVQ
KHQQRYQKQARHQSNTKSGTTPWKPCPGCGGSHWLKDCKNPKRVECKYCKRAGHLEKDCR
IKQRDQNKKGAESTINSVVIQAAATSGSNRIYREIEVNGKPIRMQFDTGADVTLFHETDW
IKLGRPQLHKPTISVRSANNQPISVKGWFECNVAIGKDTHVLKAHVAETSTLLGTDWISR
DQQLWNALNGSERINLVGSLTGSACDFLDGAREQLKRSLENSFPQVFQPGLGKCTKMKAE
IKLKPDAKPVFRKARPVPYATLSAVSEELDRLTLQGVLTPVDHSSWAAPTVTVKKKNGSI
RMCADYSTGLNDSIEQHRHPLPTADSIFTSINGGKYFTQIDLAEAYLQMELSDESKELLC
INTHKGLYQFNRLPFGIRFLGFIVDKNGRRPDPEKIAAIKNMPVPKDVSQVKSFLGLIQF
YGAFVKSLFRLRPPLDALTKKDTPFRWSRACQNAFDKIKEVLQSDLLLTHYDPNKPIIVA
ADASQYGIGAVLSHRYPDGSEKAVFHISKSLNKAQQNYSQIEKEGFALVTAVTKFHKYLH
GRLFILKTDHKPLLSIFGDKKGVPVYSANRLQRWAVILLNYQFKIEYVNTMSFGQADALS
RLIAENADSKEQEDHVIAQVELDITDTFAQGCQQLPVNAHTIRSYSRKDTSLQEVYKAIQ
TGQWPKSVPKNSPLWEYYNRREDLYIVQGCIMFGERILVPPILRNRVLKMLHRAHPGIVR
MKKLARGFVYWCGMDSDIQKMVQSCDQCAAVAKDPVKTTLCSWPMPTAPWQRVHADYVGP
IHGKYYLVMVDAFSKWPEIRTTTSITTSATLKLLQHVFSQFGIPDTLVTDNGSQFTSSAF
NEFCKSQGINHMRSPPYHPQSNGQAERFVDTLKRALGKLKGEETDDTALNIFLQNYRSTP
CDASPNHVTPAENFIGRRIKTFLNQLLPSSAPVSSDHNHKMEAQFNRHHGSRTKKFAPHD
KVYVKSFRNLNATTWIPGIIICRLGKTLYSVRVNGNTTWKRHANQLRRRESPPTLKTIPM
DLLAEMKSEEPTLSPDIATPNLSPPRATNNPVPTPSPPAVLRRSTRPSRPPSRLTLDPNQ
KTYRPPN
Download sequence
Identical sequences E3NEM4
XP_003093149.1.11157 31234.CRE08564 CRE08564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]