SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE08804
Domain Number - Region: 397-427
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0199
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08804
Sequence length 479
Comment (Caenorhabditis remanei)
Sequence
MFTVPCSPNGISTNITFFAQYAGFRKVCSINCGGRYTEYFKITGTLKFTGSMWTSIYRII
EGKTTLMNEIAWPDLSHLAQCFSDWIQEDCQMDAFLFRHPAYSMSHDLFFCPAPMPTIPS
KDGQTTCLRVVTSATLGVPSKIVKQFKLFSAMDIQEILRAASTIKKHAKILEKIENEKAA
DKEKEIEIHLAPKWGIDPTKSTLDEMEQFIAQLKEEGAEFQKDLEFAKEEEKVAHQKYVI
HLDTSKMKKIENLTVKRAEELNKEADELEKQVNMANAVIGDIEAMIGFKNDVLKLVEKWT
RNATFEFHRTGKKPDESHAQFLARTQGGEVPQVEKDPRTEKAIKTTQRQEKEDRKTDPME
HKHTLQSVVSKPTKRPAPSREIETNEIKRQQKIRRITSFGEDKPNMKCSFCGGGHFSNQC
PQHPSIADRKDIVKRDRLCEHCLLVKTKDPCGCRERTCYYCKSTNHHSALCSLPQTIID
Download sequence
Identical sequences E3LHM2
CRE08804 XP_003116463.1.11157 31234.CRE08804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]