SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08848 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08848
Domain Number 1 Region: 544-698
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.55e-42
Family Retroviral integrase, catalytic domain 0.004
Further Details:      
 
Domain Number 2 Region: 352-442
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000018
Family Retroviral protease (retropepsin) 0.014
Further Details:      
 
Domain Number 3 Region: 283-324
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000085
Family Retrovirus zinc finger-like domains 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08848
Sequence length 901
Comment (Caenorhabditis remanei)
Sequence
MSDADMNRKFIEMMELMQKQMAEQARKHEETIAVLTKAVAEKSHIDGSLGTSSGLTVSQS
QLMNDVGGRISVFQFDLETEKTFSKWYARYGTAFTEEGKGLDDKNRVALLVSKLSEEVYE
QYSRRICPKLHHEVNFKDTVDILKEMFDIKKSLFSHRFACINIARDGDSPVEYTNKVNSL
CELAMLKDIDPDGWKVFFWLRGLDPTQDTKARAYFLKYVEKKTELGEKVNINELCTEWQK
LLSQTSAVSEMEKSDTAVRAVYAKKPSNQDQSRDKNTSEYDYSEGGKCWNCGKRGHKKPD
CPKPLTTCFDCQKKGHMSSFCRARNDSSSRKTQHVAIVGGASSEDAEVNSVRQYVSVDVN
SESVEFQLDTGSDITLIGREDWSRIGKPDLERCRSKVKSASGNELKILGRALVEFRLKGS
VGTGYVYVREHGNLLGLDWIGRSKEMSYHMGMMVDKLTHSNTDAIHGGLNGKFPEVFKKG
LKRCVKKKAVLKVKENATPVSRSKRSGVQGASRVVEKVVSSCTISQGGKIPRKIPVQPWK
APERVWQRVHIDYAGPENGQYYLVAVDAKSKWAEVKIVKSISAVSTVRTLKDMFSQHGYP
ETLVSDNGTQFVSKEFATMCQEAGIEHVRSPAFHPQSNGQAERFVDTLKRGLKKLKGEGS
VNNEILSQFLLHYRSTPSNALGGLTPAEVHLGRRLRTRLSLMIPQLNKTVDSEQVAMKEQ
FDKHHGVKVRSYRKGDSVFVKVFEKNTWSWKPGKVNQRQGRVVYVIGLNDGRERVVHANQ
MKMRLEESTQEQSKEHEWATTMFDVFELPTVWSARKSTDEARRDNATSTPVMDSPQRVHQ
GQGTSSSPAQQVQSRASTQQSSSQSTTTAVQGQRLAPSPVQPRRTTRVRKNVVKYDPSDH
S
Download sequence
Identical sequences E3LHU9
XP_003116157.1.11157 CRE08848 31234.CRE08848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]