SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09308
Domain Number 1 Region: 812-1251
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-147
Family Reverse transcriptase 0.0000172
Further Details:      
 
Domain Number 2 Region: 1437-1597
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.79e-35
Family Retroviral integrase, catalytic domain 0.0081
Further Details:      
 
Domain Number 3 Region: 520-548
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000488
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 
Weak hits

Sequence:  31234.CRE09308
Domain Number - Region: 575-677
Classification Level Classification E-value
Superfamily Acid proteases 0.000131
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09308
Sequence length 2044
Comment (Caenorhabditis remanei)
Sequence
MGDGMDDDLERSMASGDDKVSMGAVQMSLAERRKRTVGFANFLATVGQVEEEVQQLLKTM
TVVSSRQVDVVQGPWRKFRKELTERFKELDEDKWPRAVMRIMRESGLESLGELKNKCEKT
GGGGEGNVGNVGEEKWLEEIEGIKNENRLLQVAWNEEREGMARRIQELEREKEQMMQKAK
RLEKLAKEEKKAAESMKANLQFVQGKTTEKLSERTASLQEDSKNAGKRSRTSSSSSTARY
WSLENQKGKLPPVENGEDWEDKVKQWSSERRGSVGMKENGWERGSVNAGSQAMESEVQGM
VQCMSRMMKASALPEPKVFDGKGDFKEFKRAFLLKYNQVTDTDDELVAILEEKFLGGAAK
SLFKTLPKRYERSIKSLFEEFEMKLRKRQGDSKAEALNEFEGLRKHPNQKMWEYLVEVEK
WSKKAFAEAGAVTLSQLRTTKLMMAARRDDTLHKMLVMKRLELPLEDQYEHLKDIVLQQE
NEKRRDYGWRRGTVGGHKEREGGNEKDRGDNSRIGGKEDEGGRRKEGFKIKCFKCGGIGH
MSRQCTSKPVQEVAMKKVVGDTEKTVVGAEAAEVVEVLGQKKRMVIDSGAVVSVVSKSAW
EALKAGCQQWESEVEMLGKPDFTIVNASKGSMPVCEQIRLPIVVRGRRAVVVFQVVENEA
EVFLLGTNAFESIGVELKWKAERAVARAAEKLRVPPQSCAQILLTTEVDLGEQVLLESKE
ECVPTSLCAKNENGCLTVVVSNWKDEPLLIKKNQVMGVVVREWKLQNSGEYKEVNMMDLD
RKMGLKGNARVEEVLGILKENGEIPEGRIPKILQEYSDVFAVEESELTQTEMAKCGIELQ
EEKPIRQKCRPVPLALHDKLKAMLKDMEQRRVIKKCRSPWASPVVLVKKKDGSIRMCVDY
RKLNAVIKLNAHPLPHIESTLQALGRKKWFTTLDLMAGYWQIPMEEESKEKTAFTVLNEQ
YQFEVMPFGLATSPAIFQEAMEQVLGEWIGKSVFVYIDDILIASESMEEHAADLAKVLRR
IRDCGLKLKAQKCKIAQKSVEYLGHVIDELGVRTDGKKVEKVENFPIPKDRVELHSFLGL
CTYYRNFVMNFSSIAAPLTPLTSPKVAWRWTSEQQEAFEELKRRMTSAPVLAQPDIEAAR
SFERPFCIFTDASGYGIGAVLAQVGLDGKVHPIAFASKALTPAEKNYHVSDKEALAVLFA
TRRFKHFIFGCPTTVFTDHQPLTSLFKGKKLADRLLRWSMEMQDFALNIVYLKGKANPVA
DALSRGGAQEIEEMKEVHEQARMEVVRVVNEVSVVEKEETAKRSWKETLEKDEKWRGIIR
KLEKGQQDGMVEVPGEGKRDLSEFMMVGDELMLVTKYGATLKVVPEEKRKEVFQEAHGGI
FGGHWSPEKVGAMLEKRVWWPRMRAWIGKWSKECQQCLCSNAKQILTAPLTAIETSEPLE
IVALDLLDLGRSAHGNRYVLTIVDLFSRYAGVCAIPDKSAETVAKAFVENWLLKEGRVPK
AILTDQGLEFANATFEKVAKMSNIKLIRTKGYNSRMNGAVERFNRTIQTVLKKITVIPAE
WDEKLPYAVFAYNSCRHDATGESPHYLMYGRDARIPMKADAEELVGRYQVDTDEYKFRHA
EQMNSAQEEARAHIKREQEDAKRYFDKKHGVHKIRYPVVGDRVLIKSPSEKIGTKNAKLR
NEWQGMYRVLKTTENSAEVIPIVGGKEKIWVPWEHVRKVPIEVPEMSVKAKTRRGKRGVR
ESGESGVHEIRNIEISVENMNSFRNFVINGCDCKFGPCHVKLDEQSCRTLEEAANVLVMR
NKQIRGADGHMMMHSVMVRKEVGEPEKVEALKMFAKECSMVAKAIMNSTIQEKEWKAAAE
EVKKEVEERLKPKKTVIREPEILIGPRMGIKGKGLLEMREANADGWVDKYDFEQVQTAVF
LLTLTTDEEKNKRTGDVIDKLAREVKELVVCPFRMDCTFAEVPLVTETWKRTLMTSANAI
WIEPMKCVGAKQMPMITTAPERFKTVKELADFLEAVMPSGGIVEMLKKDLEKEPPSKRSR
PSHQ
Download sequence
Identical sequences E3LI34
CRE09308 31234.CRE09308 XP_003116443.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]