SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09693 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09693
Domain Number 1 Region: 530-630
Classification Level Classification E-value
Superfamily Acid proteases 0.00000493
Family Retroviral protease (retropepsin) 0.026
Further Details:      
 
Domain Number 2 Region: 480-507
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000576
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09693
Sequence length 858
Comment (Caenorhabditis remanei)
Sequence
MSDKTASKQSTSKVDDDRMIVVETQMSVKDRRKKVKNFTKLIASSVKVEDETRLQLGELT
TKCSETEVDAILEPMKSFHRELLEKFEEIGGDKWPRSVIRVMREFELESVAELREACAKA
AEGEEAEWSVGKVNLELQQVQYEMKVLTECWNEEREMLGEQIRKVQEEKEVAEIQVSKLE
KALKQLRKTLERQERRPNGLWDETQGSRSWCERVENWDIERNDERSRKKGGEDAFSRKTL
SHSGSSEVNDMMQCMNRMLKSSALPEPKTFDGTGEFKEFKRAFLLKYNHVTENDYELVAI
LEEKFLKGAAKSLFKTLPKRFERSIQSLFEEFEQKLRKRQGDSKIEALNEFEGLEKRSDQ
KMWEYLVEVEKWSRKAFPEVKQETLSQMRTTKLMKAVRGDETLHKMLIMKRFELSLEEQY
DHLKDIVLQQENEQRRGNGQKSGYSEGWKGRKDSQWKEREEERPKAENDGEKGETVADRG
SGEKQYWREQRCFSCGGVGHLARQCSPKPVQSVEVRGKGEGVGIVAVETVMMLGQERKMV
IDSGAAVSVMSTGAWNGLKKGCRNWMEVVKRLGKPNFEVIDTSKKKMRIIQQIEVPIQVR
DRKAEVVFQLVENDAEIMLLGTNAFESIGVSVEWKQERTDVQQKKGKRDARSREEKKVFM
VGNLGIRVENTKLSGKTAEKSKEIAVDTVTEEKKEGMKPKKTVIRESKILITPRIAVKGK
SIFEYRKSALNTWKDKFDFVNVESIVFLLELTEDEETNQKLGNLVRKLAEEVKEITIIPY
KMDWAESGLVESWKRSWITAGHVKWSDSAASAGEKFKTWEQLLEFLEARTTGNVVVAQLR
KESVTSEPRIKENKWSHQ
Download sequence
Identical sequences E3MX21
CRE09693 31234.CRE09693 XP_003099317.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]