SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09731
Domain Number 1 Region: 309-403
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000603
Family Retroviral protease (retropepsin) 0.04
Further Details:      
 
Domain Number 2 Region: 495-523
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000129
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09731
Sequence length 626
Comment (Caenorhabditis remanei)
Sequence
MVARPTRFIGVEVYSLVHRNFILPAPAIRLVPDNRRTPMIIRHQVSIGGCTTSVRRRSFA
EVVIGASRPQFRAFSGDAKRTGHPMQFNATTSVSSEEMPIREEASAVIVPICEESIALVS
SIREGSSVLVSTIREESDVLVREGSDNWHSPICEESCEMDPWHRDESRGLDTPYSINTEV
RSSVSSGIGKQVSPVVTVTICEGSDNDAVANDNVKGCNQNILTELCSILKQPLVLRHFQL
EQALKAKNEQVEALQQRLERLTDQEHEGNFRSECYTLQCRKGNAQVAEPGCDAEYKDFGA
PASIISASIPIEANDYACLALVDTGATITLTSGVMCSRLGLPEPEPPIKKTVIGFGNASV
KIAGSRVITFTIGSYRINHRVHITAEPLGDYDFLLGIDLLSRLPNIGFDLREAKMSIGKD
VLPLGERAKCQECQRRSLENKTLKVQKSSWSEEAHEGTYTDFVIVDSWAEEMESSQVQEA
VESKPSKLTKRPKLQSTPRRKGTCHYCKEEGHFARECHKKAKLVASKKDQRPNHPAILDR
GEDISSSHTQLAQEIETLRKQVEELFTLNRKLISERFTSCEHTSAAPQQSTEVEKTEVEV
EKTEEEQNVTSSSHCDQEQKDRQSSM
Download sequence
Identical sequences E3N4W4
CRE09731 XP_003096554.1.11157 31234.CRE09731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]