SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09733 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09733
Domain Number 1 Region: 1420-1808
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.09e-124
Family Reverse transcriptase 0.0000451
Further Details:      
 
Domain Number 2 Region: 2020-2175
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-36
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 1204-1304
Classification Level Classification E-value
Superfamily Acid proteases 0.000000003
Family Retroviral protease (retropepsin) 0.031
Further Details:      
 
Weak hits

Sequence:  31234.CRE09733
Domain Number - Region: 408-438
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000209
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Domain Number - Region: 1327-1415
Classification Level Classification E-value
Superfamily dUTPase-like 0.0085
Family dUTPase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09733
Sequence length 2404
Comment (Caenorhabditis remanei)
Sequence
MNSLVNADNPPPTEQVATPTSPELPKHITLATETAVEHIRTAKLTGQTLIELRECVSADL
RAIHLRLGRLTELSVDRFENLEARVGILEGTPSNEPASTQTLVGSSSEKTAEDPNVLSTT
DDSTTAPEKDSQKTDNMKTPTRPPPLVLQIAPHRPDLDGTPYPPTTTRSAPPANEQDDSE
ATPRVTRAAPKKSESYYFNVLNGKMAAHIPTFSGAPHENFAAFARSFTDHANAMKDTLTN
DKKKAVFLTYLTDFARDKAEELLESKPDALFEDLVEHLKSTFQDPTRAEMERQQLRQCSQ
HQDESVDAFGARVRKLAQSAYVGKSREYIADKAKEAFIDGLTFTLKFHVKGPRDFQEAQN
SALKFELLLAEAAKANTITPQGLSFAPPPQNTPSQPAHPPQPAYQHQQLNFPTPPRRTVC
YSCGYEGHYAADCRRRQGNHYQNRDPRNNNRGYRGNNNGGYRNNGGSRGNNGGYRNQEGG
QRQQFPVNDPVQRHQIPSPQQEQHRRFVNSLAPTENPLVEQLRTELATSRAQLDALVQRN
SELATAASTASPSRRINCVSRGSYMLSICALATFLSLMGSASALEPLVCMHYAPESYVQV
PSPLDCTIANTMTPTAKATPLELAIFRDNTINYRTNGTLCKVVKQVTTFSVNIFGARLQE
SSSKQLPVSTEACANMVKFQECEFGDLHHRAGIFKTENAHIINWPSAFNIFAGTQVVETT
NCFMMPTSVYSRFGSETPSSPAGSLLGCRFSDGSCSTRGGATFIWTPTQDQQCRFVFWKK
LRGVQSGRIWLSEDKEFALSFLPNNSRIADCGRKIVVTDQGYGIVLPSRTKRQAEGLNEL
TNFVTSNQLAAQLLANEEAVMESASKLVRFGYKNLCHASNSQRAMVLSAIVSNPTMAARK
LTKKDHIKAKFLGEGLLAIKPCSVVPKGLYEFIPFKETCYSKPSIRVTTPTNTTIVTFVD
LTTRIITNRAHPVDCNLIANFEYMVNGTLFSLNPFTLELKTHPDFRARQISETPAFQNPI
GEETPLIFHNLIIGSLSENMPESHYNEIWEAMQGSPEALTRIVSTHSDPSSGPLLAKQIE
EAFDFWERIKSVGRVIFVIWTVVCNTVITILTLVAIIAGVARFYIGPWLVSLKRTEPKAT
QFIGTGADVQSPAAETPVVSPQETPRILNKLAGPIPDCARQMKRLRSPASVLTYTDPKYF
TAQIPIRVNGIHFWALVDTGAGFTVAGREICALIGVGKLNPPTVDHALGLGGNEVGMAGS
ATIKFEIGANTIFQTTNFTSGQCCPEGVSNYDFILGNDILSRLPKFFLDYPNKCFEVGDE
KLPLGSPKMETVFPYRYKVHVAKNTVIPPRSEAFVKCVVPLCQEEKDLVLLSQANSLVAQ
DLIVAPAIFVPSKAFLLVTNPTNEPKTLYANTTAATATDAELEKHINSLLRSRRITESNT
PWTSPIVIVTKKNGSLTVCLDFRKLNEATIPDNFPLPRIDAILEKVGGSNFFSSLDMANG
YLQLRLDASSSYKCGFITENKVYAYTHLPFGLKSAASYFQRALRTVLNGLEEEVLVYIDD
ILVFSKTFEQHVISLRKVLQRFRDFNLKASPKKCEFAKKAITFLGHEIGKDSYSPDKANV
AKIVEFPVPSNVNEVRRFVGMAGFFRKFISKFSEIAEPLTRLTRKEQKFTWDSAQQAAFE
KLRTALASEPILGFPDYDKPFHIFCDASAVAQGAALMQTRPDSEKDFYGIAYASRTLSDP
ETRWPAIQVEMGAIIFALRQFKPYICMSKIILHSDHKPLTFLLQKAKAHDNLSRWLIELQ
CYDIHIVHIDGKKNTVADCLSRARENESLEELTELKDIIDFPICMTLALPDPQTDHTNRA
TGPVGIGSLVVSQRKVHLTRKNQPTISLDFAAEQEKDSNILIVKKILKNQSPEDSVPEPL
ASRLTLSELAPNGTVLTKPYGFSKRALPWVPAHLTSLIFEAFHESYLSGGHFNGMKTRVK
IERRYFWPGMAKEIWAKCKACLKCQAKNSPVPAYRERLRTVVTTKVFQKVGVDLTGPLRT
TPWNNKYILNIVCWFSKFIVSVPLPDARSDTVARALLNECVLKYGAMTELVSDNASTFTS
HAFGSFCQLLSVRHHYAIPYHSKGNGATERSFRTFHQLVSKYVNKSHTDWDSILPAITFC
YNTTVHSTTGETPFFLMHGRDPTFGIDRIIDPTPAQLSSEDDNIENFRQELIANLREAWF
HAKEQADKARTLFARTYDAKTRPSEIIVGDRVLFKNYLSKKDLSRKLVLPWVGQYRVLEV
TPPEAVIQDIGSPKKAPRRVHLDQIKKFVEITGPAATDRDEGPDSDEEAEQDVRAAQADQ
AETTGIDTAAEGEVRPLETIPEEGLDQTTGANDIRESSPTEGDEQQHRYGLRRNRNPPER
FERR
Download sequence
Identical sequences E3N4W7
CRE09733 31234.CRE09733 XP_003096551.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]