SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09882 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09882
Domain Number 1 Region: 371-806
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.11e-120
Family Reverse transcriptase 0.0000964
Further Details:      
 
Domain Number 2 Region: 986-1142
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.18e-40
Family Retroviral integrase, catalytic domain 0.0085
Further Details:      
 
Domain Number 3 Region: 238-333
Classification Level Classification E-value
Superfamily Acid proteases 1.13e-16
Family Retroviral protease (retropepsin) 0.0085
Further Details:      
 
Domain Number 4 Region: 171-215
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000135
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09882
Sequence length 1305
Comment (Caenorhabditis remanei)
Sequence
MADSPTQHGDQDTQAAILKLTEQVMNLMTIFTQNQTPPAAASSTTVASTFDSSKLMNTIS
SRIPMFTYVPEEEKTFEVWFSRYKEIVTKDGAQLADDTKTRVILDSSYQDIRTRALQVLE
QKPRITLLEMEAEVKRGLDIRADSKAVAPSNQSPEVQAVQKKPQNQHNQNKTEKQPPSPC
YRCGGNHWSKDCKYQTATCRTCNKPGHIAKSCRSKPRDHPKVSHKVKTVFVGVAATHGST
RIYKSVTINGKPIKMLLDTGADVTLVNLTDWKRLGRPKLEPPSIRVRAANNQVITVKGSF
NCNFELNGVRATGTAHVTETNTLLGIDWVAQDQTFWNLLHDAPTINSANTSSGSACSYLD
GLRDGLKVDLSSEYPDVFQSGLGLCTKMRAKLKLKPNAQPVFRKSRPVPYASLEALSNEI
DRLEATGVLKSLDHSDWAAPVVAVTKKNGSIRLCSDFSTGLNDAIEAHQHPLPTADDIFA
KLNGGKFFSQIDLADAYLQIEVDDDSKKLLVINTHKGLFHYNRLPFGVKAAPGIFQQVMD
TMLAGLDGVSCYLDDIIVTGCSIEEHNQRVKKVIERIASFGFRMRLEKCSFLMPEIQFLG
FVINEQGRKPDPQKIADIKAMPAPKNAIEVRSFLGLIQFYGTFVRDLHRLRPPLDKLTNK
DVEFKWDTECQHAFDQVKEMLQSDLLLTHYNPKLPIIVAADAPQYGIGATISHRFPDGKE
KAIYHVSKALNKAQRNYSQIEKEAFGLVTAVTKFHKFVHGRRFTLRTDHKPLLSIFGEKK
GVPIYTANRLQRWATILMNYNFSIEYINTKNFGQVDALSRLISDQMQQREETEEVVIAHI
EGDIICSLDRVCDQLPVTVDIIRSETHRDKLLMKVMECIRSGKWPVLDKAAPIWLFQQRQ
TELSIVQECVMIGERIVLPTSLKTKVLLMLHRGHPGIVRMKKLARSYVYWPAMDKDIENL
VKGCDPCAGAAKNPVKDVLHSWPCSTKPWNRVHADYCGPLQGIYYLVIVDSYSKWPEVYA
TKSITTSATIHIFRQVFAQFGNPEILVTDNGSQFSSKQLEQFCKRNGITHVRSPPFHPQS
NGQAERFVDTLKRALQKLRGEGNSDSAVTTFLQTYRATPCAASPNGLSPAENFLNRKLRT
ELDLLLPMDPNVGDRNRKMEEQFNNQHGAMPRHFVVNQKVYVKDYRYPKATWIPGIIIRK
LGGTIYDVRADDKTWRRHANQLRSRSSATACQEAADLLEMPIRFTQEPITEPVTPPSSTT
PPLPTNPIVPSQPASPSPPPLRRSSRNVHPPKRLCMDPKKKSYRR
Download sequence
Identical sequences E3NLS5
XP_003090646.1.11157 31234.CRE09882 CRE09882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]