SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09943 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09943
Domain Number 1 Region: 175-205
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000795
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Weak hits

Sequence:  31234.CRE09943
Domain Number - Region: 58-92
Classification Level Classification E-value
Superfamily TM0693-like 0.00262
Family TM0693-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09943
Sequence length 207
Comment (Caenorhabditis remanei)
Sequence
MADEDTQSTQLGEIIRKNVEAMLGSVLAAVRQPEVAPKLSAKGLQKQADFNVKVANLLSK
KVDEYPDDEDFKKIFDLIKARNAELELLDKDPRAAAMMEKATALASLTNASNGGISDPTQ
LMVLASLLPGDAGPLKRRRMNEPSHSQWFRGAGASRGESSTRYYKNSNTNGYGYQRFGHS
QGSERARSQVCYKCHQPGHYASSCQQR
Download sequence
Identical sequences E3NUM8
CRE09943 XP_003087893.1.11157 31234.CRE09943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]