SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE10440 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE10440
Domain Number - Region: 177-205
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00384
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 
Domain Number - Region: 428-469
Classification Level Classification E-value
Superfamily YjgF-like 0.00906
Family YjgF/L-PSP 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE10440
Sequence length 613
Comment (Caenorhabditis remanei)
Sequence
MTEAQSSHLETMKKLICLHQAQLAEAVMSMKDTKLRGIGQHDWRALRDMQTTDLLLENYK
SMDNAMNKIIRLVSGEEETQQQQDKHFKEEIRKFVSGTGFSALMESAGKTYEEMNSMIQS
ISTEEERWIREKLDVYQATIKPGKDIFKEVVLWIGSSKAADTKIFVAQAIKETAKIIGTK
RIPLAGPDRCVICYKEGHTKDRCSDTTIENIKRTMLSWMRLRCLQTDHTKAIHNVEMYLE
RFKPWNIIPCRYCEDSTHSAESCGIPVDAKQMAVIVKKMCNQCLSDKHASKYCNQTIGCK
YCKQAHYYRHCDQAPTTPEPNEQSSESQTRGKVREPEMKSGDQTATKQQTTKTEMTGGIV
QSERQGNDKTERPVVKLTELTLNDSTAGRHPYMVVTWFTHEHGLQNLEAYIHHHQHDLNT
MRKLFSITKMKRNGTISEDFDTCMIQITQNLKEMIEEIGGSPTDVVIVHQIPRGQTNTPK
NRDLIHTELQGIQRWMWKWSRVPDHRNREGCKFNFAKKIAQRWIKANEKKAAKEQEKNSK
SAGAKGQRCRGPQQIRSTCNKSDGQSTSQRRNDNWQRNHDQVGPQQSTSFLSVDFPAPRV
SWIYTQDISPTFM
Download sequence
Identical sequences E3N0W2
31234.CRE10440 CRE10440 XP_003097976.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]