SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE10441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE10441
Domain Number 1 Region: 326-418
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000457
Family Retroviral protease (retropepsin) 0.012
Further Details:      
 
Weak hits

Sequence:  31234.CRE10441
Domain Number - Region: 265-307
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000152
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE10441
Sequence length 418
Comment (Caenorhabditis remanei)
Sequence
MADTTTGDQIKQLTEQINTLVGVVSTLAKNQAQFQNSGNTETSTTNDTKIFDSICARIPM
FVYDAEEEKTFDNWYTRYEEVIIKDGASLAEDLKTRIVLSKLGQKDYALYTNRCLPKLPN
EISYTDTIKNLKALFKSTTSIFRKRQEFLRTEFGGGSLEEYTGTVLRRFATSEFKKMTDE
QTCAMVWIAGMRDPSYQDIRARALQVLEQKPNLTLLELESDVKRLLDIRADARAVGGSVA
ATSDVNAVQKFQKSKKNTPEKKDSKQPPSACYRCGGNHWVRDCEHKKVTCSYCKKPGHLE
KCCRNKNRENKSPKVKTVYIGAASIDGAERIYRQVQINGHCVKMLLDTGADITLLSQNDW
TALGRPKLEKPTIKVKSATHEPVKIFGSLHCKYMMNGRQESGVAFVSNTDTLLGRDWI
Download sequence
Identical sequences E3N0W5
XP_003097995.1.11157 CRE10441 31234.CRE10441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]