SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE10755 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE10755
Domain Number 1 Region: 988-1061
Classification Level Classification E-value
Superfamily Acid proteases 0.00000375
Family Retroviral protease (retropepsin) 0.031
Further Details:      
 
Weak hits

Sequence:  31234.CRE10755
Domain Number - Region: 410-434
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.012
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE10755
Sequence length 1136
Comment (Caenorhabditis remanei)
Sequence
MNSLVNADDPPPTEQVATPTSPELPEHITLANETAVEHIRTAKLTGQTLIELRECVSTDL
RAIHLRLGRLTELSVERFENFQARVGILEGTPSNEPASTQTLVGSSSEKTAEDSNAFSTT
DNTTTAPEKDSQKTDSMKTPTRPPPLVIQTASHRPDLDGTPYPPTTTRSAPPANEQNDSE
ATPRVTRAAPKKSESYYFNVLNGKMAAHIPTFSGAPHENFAAFARSFTDHANAMKDTLTN
DKKKAVFLTYLSDFARDKAEELLESKPDAMFEDLVEHLKSTFQDPTRAEMERQQLRQCSQ
HQDESVDAFGARVRKLAQSAYVGKSREYIADKAKEAFIDGLTFTLKFHVKGESPRDFQEA
QNSALKFELLLAEAAKANTITPQGLSFAPPPQNTPSQPAQPPQPAYQHQQPNFPPPPRRT
VCYSCGYEGHYAADWATATTITAVIVIMGGSRGNNGGYRNQEGGQRQQFPVNDPVQRHQI
PSPQQEQHRRFVNSLAPTENPLVEQLRTELATSRAQLDALVQRNSELATAARTASPSRRI
NCVSRGSYILSICALATFLSLMGSASALEPLVCMHYAPESYVQVPSPLDCTIANTMTTTA
KATPLELAIFRDNTINYRTNGTLCKVVKQVTTFSVNIFGARFQESSSKQLPVSTEACANM
IKFQECEFGDLHHRAGIFKTENAHTINWPSAFNIFAGTQVVETTNCFMMPTSVYSRFGSE
TPSSPAGSLVGCRFSDGSCITRGGATFIWTPTQDQQCRFVFWKKLRGVQSGRIWLSEDKE
FALSFLPNNSRIADCGRKIVVTDQGYGIVLPSRTKRQAEGLNELTNFVTSNQLAAQLLAN
EEAVLESATHSDPSSGPLLATQIEEAFDLWERIKSVGRVIFVIWTVVCNTIITILTLVAI
IAGVARFYIGPWLVSLKRTEPKATQFIGTGADVQSPAAETPVVSPQETPRILNKLAGPIP
DCARQMKRLRSPASVLSYTDPKYFTAQIPIRVNGIHFWALVDTGAGFTVAGREICALIGV
GRLNPPTVDHALGLGGNEVGMAGSATIKFEIGANTIFQTTNFTTGQCCPEGAPLRPFSSP
SAHHLFSRLLPHASIFSVSLAFSRLFENLQTHHVFWETSGRGHSPCRPVTTLFCTF
Download sequence
Identical sequences E3NS26
XP_003088795.1.11157 31234.CRE10755 CRE10755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]