SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE11513 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE11513
Domain Number 1 Region: 443-547
Classification Level Classification E-value
Superfamily Acid proteases 0.0000019
Family Retroviral protease (retropepsin) 0.026
Further Details:      
 
Domain Number 2 Region: 401-426
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000331
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE11513
Sequence length 775
Comment (Caenorhabditis remanei)
Sequence
MSDKTSSKQSTSKVDDNRMIVVETQMSVKERRKKVKKFTKIIARSNFPQELLEKFEEIGG
DEWPRSVIRVMREFKLESVEELREACAKAEEGEEAEWSVGKVNLELQQVQYKMKVLTECW
NEEREMLGEQIRKVQREKEVAEAQVSKLEKALKQLRKTLERQERKPYGLWDETQGGRSWS
RKKGGEDAFSRKTLSHSGSSEVNDMMQCMNRMLKSSALPEPKTFDGTGEFKQFKRAFLLK
YNHVTENDYELVAILEGKFLKGAAKSLFKTLPKRFERSIQSLFEEAGEEVGPEDVGVSRG
SREVVEAFPEVKQETLSQMRTTKLMKAARADETLHKMLIMKRFELSLEEQYDHLKDIVLQ
QENEQRRGNCQKSRYSECWKERPKAENDGEKDVAEKESGENRYWMEQKCFSCGGVGHLAR
QCPSKPVQSVEVRGKGEGVGKVAVETVKLLGQERRMVIDSGAAVSVMSTGAWDGLKKGCR
NWVDVVKRLGKPSFEVIDTSKKKMRIIQQIEVPIQVRDRKAEVVFQLVENDAEIMLLGTN
AFESIGVSVEWKQERMDVQQKKAKRDATSSEEKKVFMVGNLGIRVENTKPSGKTAERSKE
IAVDTVTEEKKEGMKPKKTVIRESKILITPRIGVKGKSIFEYRKSALNTWKNRFDFANVE
SIVFLLELTEDEETNQKLGDLVRKLAEEVKEITIIPYKMNGAKSGLVESWKRSWITAGRV
KWSDSAASADEKFKTWEQLLEFLEARTTENVVVAQLSKESVTSEPRIKEDKWSHQ
Download sequence
Identical sequences E3NJK7
XP_003091415.1.11157 CRE11513 31234.CRE11513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]