SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE11530 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE11530
Domain Number 1 Region: 840-1121
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.18e-98
Family Reverse transcriptase 0.00018
Further Details:      
 
Domain Number 2 Region: 715-817
Classification Level Classification E-value
Superfamily Acid proteases 0.00000131
Family Retroviral protease (retropepsin) 0.053
Further Details:      
 
Weak hits

Sequence:  31234.CRE11530
Domain Number - Region: 613-669
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00502
Family Retrovirus zinc finger-like domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE11530
Sequence length 1122
Comment (Caenorhabditis remanei)
Sequence
MTLPVEVPPDDELVDQTAEGQKNVTENVGVGNKDKEDKGSVPQPMEVEENVSLSVVKKTR
EMFLKLAKEDTGKMLKTYAKANASTHESIMKPFIDLIVSTFQTLDAKEEDCEELAKENKE
LEKENEEVINKNEILQSLLEGMQDRELGGTSNSKQAMEYQMVSMLASEGINTLEDLEEVF
GNTEKLQKLIKMQNDVYQASQQKAQQMEAEIRRLKKALKDSESRVKSLKGTQAEKEEQTR
FIELNQKSNSFSRIGECTSCMSLKEMNSQIKENASQPTKSTGTTTLTSGMPQKVQKRTVQ
EQTHTDKELEEVIEAARGQMDSESDSERADETIGNGRYYTNWDTGKQKEMSPVEMMNKML
VQQNLPEPPKFSAEENSIKLESFRKSFALKFESCSDENQIILLETKYLSGRALRIFRGLP
EHEKKSINGVMQAMAIRLRISPEDETRRAKSRWESLRKKPEQNIEDFCLSIDELARVAFK
RVNASELSSFKTAKLLDAIAENETLSCLIDNRLLGMPERDHYDTCRMLATRYEQGIRDRN
LRNKSQNSEKKKSPSPQSSNTSSANNTSVQSNPNGQRTNTYSQNRNNFTNKTDNAGSPIN
QNWRQRTGENSDNNGKTKGFIECSECKLVGCHDPKCSKAPGNAKTYSRPVVTCYRCQEQG
HIATYCTMQSQNKVNDNPVKENTVNAVEDKQGLTIPSDAHKTDNTTEKPLIKVEKGRIGN
TEVDLMLDSGACISIIPQKIWKKIVGENGEEWVKKVKEEKPELAQVFTANNQPLKLLCTV
EVETSMQTRTRLIKYYIAAIDRENIILGMDQFNKLGVEVRIEEQPRAESSSESETEVWNV
IQSFQNIFAIEDSELGRTNATTCEIELLDGAEPIRQKPRPIPLAIRPEIRKILQKMVMQG
VIRISKSPWSSPVVIVKKKDGSVRMCVDYRKVNKVVKNNAHPLPHIEATLQSLSGKRIFT
TLDLLAGYWQIPLDEKSKEITAFAIGSELYEYNVLPFGLVTSPAVFQATMEAVVGDLLGK
TAYVYVDDLLIASETMEQHVQDLKAVLVRLEKSGMKLRASKCHIAQKEVEYLGHRITPEG
VKTEETKVNKMKNFKRPENAEQMRSFLGLTSYYRKFMLNYAQ
Download sequence
Identical sequences E3NM59
31234.CRE11530 CRE11530 XP_003090513.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]