SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE11585 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE11585
Domain Number 1 Region: 166-188
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000174
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE11585
Sequence length 189
Comment (Caenorhabditis remanei)
Sequence
MVDEGVLGGQLEEIIRKELQKLVAPVMAAVRQPEVTPKLNAKGLQKQADFNTKVANLIGK
KLDDYPEDDDLKKIFEMLKSRNAELELVDRDPRAAAMMEKATTLANLSNSGIGGLTDPAQ
LMLLASLLPEESGPQKRRRFEEPSRTPSQWFRGPGASRGEGSTRFGTSYNNGYKCFKCGQ
MGHFASQCN
Download sequence
Identical sequences E3NPV5
XP_003089568.1.11157 CRE11585 31234.CRE11585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]