SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE11669 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE11669
Domain Number 1 Region: 863-964
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000225
Family Retroviral protease (retropepsin) 0.021
Further Details:      
 
Weak hits

Sequence:  31234.CRE11669
Domain Number - Region: 730-752
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000112
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE11669
Sequence length 1078
Comment (Caenorhabditis remanei)
Sequence
MMVTLAMSRVSDTTENAVLEVKGARGFCTVGPASFTGSPPRISSSNLPLQSGISYVALAI
SSENPFLCRGENQKQFWAFEASAVPSVTDFQKIVQLRSTCNIGDKRRSSAIFAERRNEVD
NNTTCTEDKSATRKASDSSEVKAVEVRSQGPIRVYTLCVNDHKLIRGTSIVISNREAIHI
SRYSCENNHKLIRGTAVMSGGPEKAERCVVLCVNNHMLIGGTSIAFCSREAIPTVTDTFE
NDHMLIGGTSICFSVSEKTLMFKALMRNDLKMVGRSQFVKSSLETISQLAAVIRLMAEDE
TSASTDAEAKKNNVSAEQKRTYASTDTVESTKDTRVLSHTFSSVTGVVRKQKLALIAMSV
NGNDVKSSEPLTTSSKKKEEHPKFAKLELVNKQSQKTSKTSRSQHTTARSQVIKTNGKKT
GKKFTGRPVTRQQQVNSAKCRAEPTYQKAVKDNDTEMRISTSRQLXXXXSWVTPAFGFCT
VGARRVLLGSSPQKNVSVVISNTPDEPAFFLTASATKLQKYPRIFMVSFANGPQLQSFAG
KIEEDFNVFERTFRDRIALSTMKPEMHLTCLLNYLIEDARDKAEEVIKKNEDASFQDVID
ALRHRFSSSHKVSAAKSQFRSTKRVAGEAVEVFYRRIVCLARLAYGDSNDEFAKHLIVET
FTRGLSFDIKLQIMKKDLKEPEDILLRAMKIEADLNAESDVPVNSTSQTNDSLPQVTAVH
SKRVSERSLKNGRVKGTCHNCKSKGHYASDCWREVQVNRKHKSQSNHKTTPASTSSVTES
SNDNEMIEKLKQQIKLKEEQLQFKDAQISKLKKKQEGRTQKQVKFNDADHSVSIVHESGN
TGQNISEVGQSPSTSHMCPYIASVPIRANGYATTALIDTGAQITVSSKHMCKVLGITQLE
QPLSTHASGFGLNSVEISGTYMVTYTIGSYKIRHKTHFTVSRCTPDPFGGVEIIIGTDIL
SRMPPVQFDFRNARLQIGDDVILLGSKQPPRILFSIPCSPVSLTEAISSLQQFTDAVQKD
RDNKSVQFKNRSKKQSRNRNSSPRSAGHQTQVPGTTESSSHVRFQEVSDESQSSRPNQ
Download sequence
Identical sequences E3M407
CRE11669 31234.CRE11669 XP_003109106.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]