SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE11685 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE11685
Domain Number 1 Region: 257-691
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3e-49
Family Reverse transcriptase 0.0014
Further Details:      
 
Domain Number 2 Region: 936-1120
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 9.71e-33
Family Lambda integrase-like, catalytic core 0.012
Further Details:      
 
Domain Number 3 Region: 184-222
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000106
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE11685
Sequence length 1143
Comment (Caenorhabditis remanei)
Sequence
MADVLGGVSNEVLEKFGETILGKVADLIRDVGVDRKKKEKDVEEEKPPKVNSKGIQKNLD
FNVKLRNILTKAVALGELDEAVKEVLELLKTRNGELMLLDADPSLLQTKEKLDALKAITG
GTSEGSTNQSDMTSLLLLSNMSGGSNRNGGLHMESKRRRLEPYPGRQQWFRSESAFRGHG
SARQNGGQGYGNSRDVKRSVKCFKCSQFGHYATDCMSFPERLSEAIEFWGNICSSEWVLS
VIEDGYIIQLDSRVTLPEPQGLRPSVLRHKDFLFAEIERLEEEGVLERSDRLPRAVSPLH
VVEQGKKKRMILDLSELNKSLVPPRFKLENMKTAWPFLENANFAATFDFKSGYHHIKIHR
DSRDLLSFSLSNPPAAPYFFFKGLPFGLATAPWLFTKIFKVLVRKWRAEGIKMFLYLDDG
LIVGETEYEVARASRRVRGDLAEAGVCVAEEKSFWVPDAKFTWLGYECDLVAREVRGTEK
RMATWQSVLDELRRSVAPSVLDRMKFLGCLASFELVAGDVGVGRARWLMQTVGESQKKME
SKNTRKEKSPGEIREIEFWKVHGEELLKRSLLEIEPCFDFLLFTDASARGVGGLLKDKKG
CVLWKMSEIGDSNFEEQSSAWRELTAVDVASARLIGQVRGSIQVLVDSQAAVSVLRRGSM
KPELHALAERVWKNFESIGGCSFLWIPREQNVEADEASRNFDFDDWGIADRVFKQAQRLW
GEIKVDWFADAQNKKTERFFSRYPEFGSSGVNVFEHIPRAERMGLAWWVPPPVMIPQLLK
IAKSRGLKGVLVAPLWKSHPSYQALVDSSGRFVRYVRDYIIYEKNDNIFIPGEGSKYCEA
TDSKFSVPFDSKAMSTAKAYKEENEKRNLWIAQRNLPVDESSLLLYLVDKAKRIGSSALT
RISAAYQTANESLSTIGSSFVSDLIRSKRREEIQSRKKMVEVTVEDVSKIVELAMKEDSP
AKDRDALLAVLSFNVMLRASEAAEIKWSGVKQKDGMMEVFVEKAKNDQLGLGRHSYFNYE
PGSDTDILMCRWRLRTKGKCPYVFSNLDGSVKLSAQSISALSTKMLRAIGKPGATHHCFR
RGGANHMRASGHSMEEIQTRGRWRSLVGLQRYIKDVPRAQGCSHPQEMLEDQVEDDEEFE
YNK
Download sequence
Identical sequences E3M441
31234.CRE11685 XP_003108824.1.11157 CRE11685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]