SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE11792 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE11792
Domain Number - Region: 104-150
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00109
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE11792
Sequence length 220
Comment (Caenorhabditis remanei)
Sequence
MDQKKNEQCKTDQVDSSGRTKNTSTQTTLTGRHPETTLLQAATEYLQARIAYDREIIGDL
EPRRESQRGMNRRCQSQTSTVWKTIDTVSLLWEVTKKTADISNPEKKVIYFRVERQRQSE
IDDEIQKLMCFLPKRRSGPQKLSRNQILNILIFRELYEVALEELKDEHVKKRDTENHSTS
GQPSSSAQPSTLEQVSISEQPSTSDVKKASSKWFSPEESC
Download sequence
Identical sequences E3M4Q0
XP_003108985.1.11157 31234.CRE11792 CRE11792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]