SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE11881 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE11881
Domain Number 1 Region: 33-77
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000000000994
Family N-terminal domain of RNase HI 0.0007
Further Details:      
 
Domain Number 2 Region: 134-191
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000392
Family Ribonuclease H 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE11881
Sequence length 194
Comment (Caenorhabditis remanei)
Sequence
MIYKLEPVTLIRTDFECIIQQSASSASMGKNDQYYAVARGRQVGIYRNWNDCKTQIDGFQ
NARYKKFVNEAEARKFIAENLSVPGKKLPTSTDMPASSTEVTRKRKFEGTKRCSPVKKTR
LEETVTDPEFIDAPVVYTDGACSSNGTNRARAGWGVYWGDDSPDNEYGAVYGAPTNNRGE
LIAVEKALEKVRSE
Download sequence
Identical sequences E3M4A1
XP_003108837.1.11157 31234.CRE11881 CRE11881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]