SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE12127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE12127
Domain Number 1 Region: 590-647
Classification Level Classification E-value
Superfamily Acid proteases 0.00000203
Family Retroviral protease (retropepsin) 0.033
Further Details:      
 
Weak hits

Sequence:  31234.CRE12127
Domain Number - Region: 112-158
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0907
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE12127
Sequence length 1312
Comment (Caenorhabditis remanei)
Sequence
MSSVTSRSRHSSVSTEMSYRGDENNSKSPRRSMSVNSAKEVLRDTNAQSINAGPSAITNG
SGRALSFPQIFEPRPDAAPIVHQTFGDRLSGAVLSNVPASAVRNPAIPSEARISCPICSG
GHDDYACESPLRSRYCAKNDLCFLCTSESHKTQECPLNYLEISKNVAKVSLKPGATIGDK
IKCSGNPSSESTEQTQSVVDSEKDYRYLSYHDLVTVLPQFNADPIKYGKFARCFDRLVMT
NPRLDDLLKFSLVETKLVGKAKRFIVDLMDPRAALEATFKALRDEFEKDNYSVVNEIRAR
FENLTFHETDYKRATLELQDCKSLILQLEELKEDVSSASFVRELARKLPRKAFKRLRPLN
ANGQTPTTEQVIGTFSEFLKENRFYERFCPWVQEDSSKIHEESVMIMIEGSTIPPPRKSG
KKRNSKSFSRGAGFNTDATEMPEHSNRKTTGKGKKNSSGAKNQKPLVSSVAGAETKRQEF
SNHGRIVTAPPTPSNRLGRQLAHSSKARLESEYPRSNNQNRVSEAHLKSETSLIPLDSVK
TVSNRVLDDPLSHRARSKLLPQTLVNECCEASGVKVEEDFSHLPFLALRTTKGKVVLALV
DTGASCSFLSQNCAKRLGLSPIGYRTAVIKGVSTTTTERMSMYRLSFATTGNPVEFFVSG
RSRFPETKFFRPRFGATDNDFLRERYIDPKVITKDRASNGRALEMIIGNDMLARILGNSI
RALLPSGRYVEFTPFGSIIFPAPRVIQFNPLIVPTATSRFHPANSISLVDPNPGNIDRAP
SSPQVQSGSTNNNDGSIAVRRSRQIANLDLSLISKNHHGIRGRNFVSQQGNCNTIGLGNP
RHGTVNRQFKGEKPRMLKCTEEIFLLDASDGSSTIRYMEPRKTQEKDMMKCSLMEEHRVT
TEFQRVSVGNRVFECILKEFKMCTHPEVMSHERSFDYFDSLAVYPRDNNLVLEQVELSKD
YRGFHPQYYNGKRSLLSENQFQAGISDRKEVIQKVHRVREMLDNGRTHVVKYQCWDAGRS
GASLVRDLTASPAPDACRPGTSEEGVLRKLTSMDACRSCAPKGRKFITTDNSGQTSDKYA
ASSDPPGRRVGLKSYCFVPTIESFDTVSDVAVSRSGAARGGIECLTPVPDVCRSDTPGKG
FNRAVPNLDAGRSDASTKESDESAPNLGIRQSSSHRRRFGLKSYCFVPTIESYDTVSDVV
AGRSGTTAKDTKQFNPTLGACRSGASKSKDDQKSSGSEYSPNVKLRRPRTIDDWAKIRLP
THRVRPYQPRKPKAKLARYVLITQAAEPQTPRSVDSCQVPDQASVTLQTKMH
Download sequence
Identical sequences E3MQ08
31234.CRE12127 XP_003101782.1.11157 CRE12127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]