SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE12579 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE12579
Domain Number 1 Region: 937-1036
Classification Level Classification E-value
Superfamily Acid proteases 0.0000457
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Weak hits

Sequence:  31234.CRE12579
Domain Number - Region: 877-911
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000628
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Domain Number - Region: 240-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000712
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Domain Number - Region: 300-374
Classification Level Classification E-value
Superfamily Acid proteases 0.0844
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE12579
Sequence length 1327
Comment (Caenorhabditis remanei)
Sequence
MSFSVERTKKGSSSVTSSEKSWAVQMNEVRLKERRKLVKGFTDFLECSGRMESDMYEALK
AACKGNERQSEVLVEPVKKYCHELRERFEELGGERWPLEIIGVMKENGVETVEELRELCE
NGVEMVPGGIVENAKKAQDELALLQDAWNKERETLFREVNKVKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQKSDPKKAGQARDTKEVPVPSRLEVVRKWSPRDSDDEFSMHGRR
GDRKTVEERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMVEML
GQRRRVVIDSGAVVSVISTTAYERLKAGCRDREKEVEVFGKPTFTVLNASNSKMRVRGQI
KIPMVVRGRKVRVVFQLRPRRETSEGPDRKYQRYSCKNRCRALERGGERASTGGLGRRVP
VSKGEEKGKKESEDSGAVILIKTITGWDIQSFNGGKMTEALVALLNNPIPRIETPRKVEI
VKSFLGGERWPLEIIGVMRENGVETVEELRELCEKGVEMVPGGIVENANKAQDELALLQD
AWNEERETLFRELNKLKEEKRLAEEAVSKYKKTLKEEREASSELRGLLRKQESEPKKAGQ
ARDTKEVPVPSRLEVVRKWPSRDSDDEFSMHSRRGEFWDSERSLGEDWKSGRSSRYSAGN
EVMMGMVASMGRIMKASALPEPKTFDGTGDFNEFKRAFLLKYQQVTDEDDELVAILEERY
LKGAAKSLFKSLGGRQERPIAELFVEFERKLRKRQGDAKAEALHEFDRLQRAPGQKLWEY
LVEVEKWSKKAYPEVEKATLSQMRTTKLMRATEDDDMLQSVLVAKRLELPLAAQYDQLKD
IVLQRENEKLRKQKERMGRLGDQGNSDGRRSPEGSNDGDRKTVGERRDSGAKMKCFTCGG
IGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMVEMLGQRRRVVIDSGAVVSVISTTAYE
RLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVRGQIRIPMVVRGRKVRVVFQLVDNWVE
RILIGTNAFESIGVELKWKDPYGLVNAKENSAEVQFIGGEKKLERPGEKLRKVPTEVSEI
QCKSVAVRGERGRRASTGDVGEVFKSEGEEKEIKKVKIRASVAVIGPRLEARGPGVLEYR
DKTITGWTQKFDWGEVKEAVVLVEYTDKEDENSKRVEFVKSVAKEVEKVWMMPRSLQCEL
GDVDKVAKQWKEWLKTSTNVEVVDPLRPVGNHKTPLILEKWHRKSLDGLQKYLHNALPSH
SVRCQWEKNTDRRPQSGLKKDLGKGCPIAERRGKWLRRSSTFSKPHGITEVKGNEYSRGN
RKTYSTS
Download sequence
Identical sequences E3M7S0
CRE12579 31234.CRE12579 XP_003107771.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]