SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE12867 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE12867
Domain Number 1 Region: 98-134
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000209
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE12867
Sequence length 644
Comment (Caenorhabditis remanei)
Sequence
MASYKQNLPPSALHRQQGSLADKKSKAEVQRDRQLEEDRKAGTAPAMVDVQTGRDINPHI
PMFISQNPWYVPSEGPTLKHQRPHEERQKKMTQIHEWYQKGTTGKSATKFRKGACENCGA
MGHQKRDCFDRPRKSNAKETNDNIAEDDYVQPKLALDFDAKRDRWNGYDPATHKQVIEDY
EHLEEARKIVKEHEMKEGEVEPTVEEGAPKDEDMYAEDADMAGVSVDMDSRTRITVRNLR
IREDTAKYLYNLAENSPYYDPKSRSMRENPFAGVAGKELEAARFSGDNFVRYSGEVTAAN
EAQVFAWQATRGGVYAHSIAEPTKLEALKKEYEKGKSTLKSETQKELLDKYGGGEHMERP
ADELLLAQTESYIEYNRKGKVIKGKERAAISSRFKEDIYPQNHTSVFGSFWREGNWGYAC
CHQFVRNSYCTGKQGIEAESSAAKGTTTSNEAVFKVPKMVESEEVKEEEEVVKEEIKEEK
SDDEEEKEEDEETEKRSPTPSSDDEEKQKEREKERQLEKERREREQRRRDKNREKRGRKK
AKLGKRKRRHRGDSDDDSNSSSGSSDSDSDSDEEMRKALKKAKREKAEGLKAAKEGDRGR
KYNTDYSNTAPTEKEMEAYRMTSVHSADPMAAYMNSKFEKKHTK
Download sequence
Identical sequences E3MQP2
31234.CRE12867 XP_003101498.1.11157 CRE12867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]