SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE13090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE13090
Domain Number 1 Region: 543-642
Classification Level Classification E-value
Superfamily Acid proteases 0.0000387
Family Retroviral protease (retropepsin) 0.016
Further Details:      
 
Weak hits

Sequence:  31234.CRE13090
Domain Number - Region: 483-517
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000398
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE13090
Sequence length 912
Comment (Caenorhabditis remanei)
Sequence
MSFSTERTKKRSSSVTSSEKSGAVQMNEVRLKERRKLVKGFTDFLECSGRMESDMYEALK
AACKGNERQSEVLVEPVKKYCHELRERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVPGGIVENANKALDELALLQDAWNEERETLFRELNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQESEPKKAGHSRDTKEVPVPSRLEVVRKWSPRDSDDEFSRHGRR
GEFSDSERSWGEDWKSGRSSRYSAGNEVMMGMVASMGRMMKASALPEPKTFDGTGDFKEF
KRAFLLKYQQVTDEDDELVAILEERYLKGAAKSLFKSLGDRQERPIAELFVEFERKLRKR
QGDAKAEALHEFDRLQKAPEQKLWEYLVEVEKWSKKAYPEVEKATLSQMRTTKLMRVTED
DDMLQSVLVAKRLELPLAAQYDQLKDIVLQRENEELRKQKERMGRLRDQGNSDGRRSPEG
SNDGDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMV
EMLGQRRRVVIDSGAVVSVMSTSAYERLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVR
GQIKIPMVVRGRKVRVVFQLVDNWVERILIGTNAFESIGVELKWKDPYGLVNAEENSAEV
QFIGGEKKLERSGEKLRKVPTEVSGIQCKSVAVRGERGRRTSTGDVGEVFKSEGEEKERK
KVKIRASVAVIGPRLEARGPGVLEYRNKTITGWTQKFDWGEVKEAVVLVEYTDKEDENSK
KVEFVKSVAKEVEKVWMMPRSLQCELGDVDKVAKQWKEWLKTAANVEVVDPLMPVGNHKT
PLILEKWHRKSLDGLQKYLHNALPSHSVRCQWEKNTDRRPQSGLKKDLGKGCPIAERRGK
WLRRSSTFSKPH
Download sequence
Identical sequences E3NBN4
XP_003094171.1.11157 CRE13090 31234.CRE13090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]