SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE13303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE13303
Domain Number 1 Region: 238-362
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000202
Family Ribonuclease H 0.0057
Further Details:      
 
Domain Number 2 Region: 189-217
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000113
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE13303
Sequence length 738
Comment (Caenorhabditis remanei)
Sequence
MTDEGQVPATGSFSMELMRQFKDEFLEMIAPELLAMRKGEEKVPELSQKGLQKQAEINVQ
VINMLNNGAADLGKAVEEVVDLLKRRNQELLLLDKDPSALKNVEKLRAIAAVTSSEGSNA
GDAKLMALAQIMSQGGDNRNQRSGARRQWFPAAGFGGRQSGVRNFSAYSQRGGHGGERAF
GTKRQFNGSSTSGDFPKRSQIQCFSCGEIGHYSTQCGRTSFWEEKLESGGMIRDMEEEFE
PQCFLFTDASAEGLGAVLKNGSGQTVMRMSELGGTGFQNESSALRELRAVQMAVERMASW
KRGAVLIHTDSQAAVIILRKGSMRRTLQIVAERVWESLRSIGQAKFIWIPREQNKEADEA
SRDFDYDDWAVQNWAFEWAQKRWGEVKCDWFADEQNTKTELFFSRLPEPGTLGADVFEHV
DKAGAIGLAWWVPPPALIPRLMRVARQKKLRGILATPLWIAHPSYQALVNERGEFIPEIR
DSRIFKVNTKIISPEGEKLAFVKNMINSLGPGNLVKAIEFLARAALEGKAPSTARDYLKE
NAARRKWIQNNGLPLNETSTLIYLASREQNKEADEASRDFDYDDWAVQNWAFEWAQKRWG
EVKCDWFADEQNTKTELFFSRLPEPGTLGADVFEHVDKAGAIGLAWWVPPPALIPRLMRV
ARQKKLRGILATPLWKAHPSYQALVNERGEFIPEIRDSRIFKVNTKIISPGRGSQRGERM
ASEFCRSPFMLAIIDFSF
Download sequence
Identical sequences E3M837
XP_003107651.1.11157 31234.CRE13303 CRE13303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]