SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE13684 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE13684
Domain Number 1 Region: 810-981
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.11e-56
Family Reverse transcriptase 0.0003
Further Details:      
 
Domain Number 2 Region: 518-546
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000209
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 
Weak hits

Sequence:  31234.CRE13684
Domain Number - Region: 573-675
Classification Level Classification E-value
Superfamily Acid proteases 0.00075
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE13684
Sequence length 984
Comment (Caenorhabditis remanei)
Sequence
MGDGMDDDLERSMASGDDKVSMGAVQMSLAERRKRTVGFANFLATVGQVEEEVQQMLKTM
TVVSSRQIDVVQGPWRKFRKELTERFKELDEDKWPRAVMRIMRESGLESLGELKNKCEKT
EGGGEGNVGNLGEEKWLEEIEGIKNENRLLQVAWNEEREGMARRIQELEMEKEQVMQKAK
RLEKLVKEEKRAAESMKSNLQFVQGKTSEKLSERNVNLQERWRNVDRRSSSSSSTSRYWD
LERPKGKMPHVENGEAWEDKVKQWASEGRGSAGMKENGWERESVKAGNQAMESEVQGMVQ
CMSRMMKASALPEPKMFDGKGDFKEFKRAFLLKYNQVTDTDDELVAILEEKFLGGAAKSL
FKALPNRYERSIRSLFEEFEMKLRKRQGDSKAEALNEFEGLRKHPNQKMWEYLVEVEKWS
KKAFAEAGAVTLSQLRTTKLMMAARRDDTLHKMLVMKRLELPLEDQYEHLKDIVLQQENE
KRRDYGWRRGPVGGYKEREGGNEKDRGDSSRIGGKEDEGGRRKEGFKIKCFKCGGIGHMS
RQCTSKPVQEVAMKKVVGDTEKTVVGAEAAEVVEVLGQKKRMVINSGAVVSVVSKSAWEA
LKAGCQQWESEVEMLGKPDFTIVNASKGSMPVCEQIRLPIVVRGRRAVVVFQVVENEAEV
FLLGTNAFESIGVELKWKAERAVARAAEKLRVPPQSCAQILLKTEVDLGEQVLLESKEEC
VPTSLCAKNENGCLTVVVSNWKDEPLLIKKNQVMGVVVREWKLQNSGEYKEVNMMDLDRK
MGLKGNARVEEVLGILKENGEIPEGMIPKILQEYSDVFAVEESELTQTDMAKCGIELQEE
KLIRQKCRPVPLALHDKLKAMLKDLEQRRVIKKCRSPWASPVVLVKKKDGSIRMCVDYRK
LNAVIKLNAHPLPHIESTLQALGRKKWFTTLDLMAGYWQIPMEEESKEKTAFTVLNEQYQ
FEVMPFGLATSPAIFQEAMEQHPG
Download sequence
Identical sequences E3N7J6
31234.CRE13684 CRE13684 XP_003095607.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]